SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G50160.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G50160.1
Domain Number 1 Region: 329-637
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.99e-83
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G50160.1   Gene: BRADI1G50160   Transcript: BRADI1G50160.1
Sequence length 661
Comment pep:novel chromosome:Brachy1.0:1:48792041:48795410:1 gene:BRADI1G50160 transcript:BRADI1G50160.1
Sequence
MATIGVLLLLTLLLELVSADVFCDNLKSVVSVLAKNTSSSPEHFATATFGQAPDIVYALA
LCRGDVLDDSSCANCVTNTFVNSVLNQMPPPPFQCYYGYVYFGLCLIVYSFNDDIFAPFN
ATGLEPFERWNVRTITSDVRLTTSEAGLVASMIHDLLVDTVDTAARMTPSRFATGLMDSR
TSFPMVYSLAQCRPDLSADDCMSCLHHLLDTINSTMSRRIGAQIHVIWCSLRYEVSVFYK
GEPMLHHKAPLAPAPAPTRTKRQRHMSKLWAIAIVVVALAAAAFLCFILYHRQLIKQRKG
QLMRLKGLRRAQDLEGEEQSVWQGKNSVFSIFDFEQVLQATNNFSQENKLGQGGFGAVYK
GQFPEGLEIAVKRLASHSGQGFNEFRNEVQLIAKLQHRNLVRLLGCCSEEEEKLLVYEYL
RNKSLDFFIFDENKRALLDWSKLVTIIEGIAHGLLYLHKHSRLRVIHRDLKPGNILLDAE
MNPKIADFGLAKIFSSDNTEGNTTRRVVGTYGYMAPEYASEGVFSIKSDVFSFGVIIFEI
LSGKRNSGSQQCGDFINLLGYAWQLWVEGRWIDLIDATLVPKSDSTEMMRCINIAFLCVQ
ENAADRPTMSDVVRMLSSETMIMVVPKQPAYVNARVGNEEAPTAPEPCSINDMTLSIIIP
R
Download sequence
Identical sequences I1H1B2
15368.BRADI1G50160.1 EG:BRADI1G50160.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]