SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G50530.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G50530.1
Domain Number 1 Region: 892-1092,1138-1181
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 2.71e-34
Family Pyruvate phosphate dikinase, N-terminal domain 0.014
Further Details:      
 
Domain Number 2 Region: 72-166
Classification Level Classification E-value
Superfamily Starch-binding domain-like 1.23e-18
Family Starch-binding domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G50530.1   Gene: BRADI1G50530   Transcript: BRADI1G50530.1
Sequence length 1182
Comment pep:novel chromosome:Brachy1.0:1:49133448:49145999:-1 gene:BRADI1G50530 transcript:BRADI1G50530.1
Sequence
MASLRPLDPSLATAAASRPRSGPVAPPSAALPLRRRGGGGALRGRRRGLLSCRAASPSAA
EITKDKNTTDPSKVLLRVFLEHQVKFGEHVGVIGSTKELGSWKKHVELVWTQDGWVGQLE
LPAETLVEFKFVIILEGGKGKTWEDGNNRVIELPKGGTFDIVCHWNMTEEPLDLSGTSKV
HKESRNITPKEVRDVSVTGNGDLAPETDSSNFGGQWQGSDAVFMRSNEHHNKSSDRMWDT
SGLGGMTLKLVEGDKVSRNWWKKLELVRELLSEPVDDQSRLEALICSAIYLKWIYTGQIS
CFEDGGHYRPNKHAEISRQIFRELEKMYYTKGISAEDVLVIRKIHPCLPSFKSEFTATVP
LTRIRDIAHRNDIPHDLKQEIKHTIQNKLHRSAGPEDLIATEAMLTRVTKNPGEYNEAFV
EQFKIFYSELKDFFNAGSLFEQLESIKESLNESGLEALSSFVKTKKSLDQVKDVKDLEVL
MKTLQSLSSLRSVLMKGLESGLRNDATDDGIAMRQKWRLCEIGLEDYSFVLLSRYINGLE
ALGGSASLAQCVGRDTSIWDDALDALIIGINQVSFSGWKPAECIAIGNELLSWKQKGLSE
NEGSEDGKYIWALRLKATLDRARRLTEEYSEALLSIFPGNVEVIGKSLGIPENSVRTYTE
AEIRAGVIFQVSKVCTVLLKAVRSVIGSSGWDVLVPGVAHGALLQVERIIPGSLSSSMKG
PVVLLVNKADGDEEVKAAGENIVGVILLQELPHLSHLGVRARQEKVVFVTCEDDDTIADL
RLLEGKHVRLGASSSDVDLSAVSDENVGDISSEPSSTQKPSNEFSLPLATDKLSYMPEPK
SYTSGENGSSSVLELAEASIESSGAKAKSCGTLSVLASLSNKVYSDQGIPAAFKVPSGAV
IPFGSMEDALKKSGSVESYTSLLERIEAAEVESGELDSLSSELQAMVSLLSPTEQTVESL
KTIFPEDARLIVRSSANVEDLAGMSAAGLYDSIPNVSLSDTKSFGAAVARVWASLYTRRA
ILSRRVAGVPQREAKMAILVQEMLEPELSFVLHTVSPSDHDTRVVEAEVAPGLGETLAAG
TRGTPWRLSCDKFDTNVTTVAFANFSEEMVVLNSGPADGEVVHLTVDYSKKALSVDGTFR
KQFGQRLAAIGQYLEQRLGSAQDVEGCLVGEDVFIVQSRPQP
Download sequence
Identical sequences I1H1G0
EG:BRADI1G50530.1 15368.BRADI1G50530.1 XP_010228078.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]