SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G50560.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI1G50560.1
Domain Number - Region: 449-501
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0162
Family Myosin rod fragments 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G50560.1   Gene: BRADI1G50560   Transcript: BRADI1G50560.1
Sequence length 509
Comment pep:novel chromosome:Brachy1.0:1:49168162:49171484:1 gene:BRADI1G50560 transcript:BRADI1G50560.1
Sequence
MEMEGRGLSDLFRNTSEEIFLKAVMENSIGVAAAPSMEMMGFRNMSQSFREDSEELFNSW
LMNGEIPGFGHLNNRPRQPSRLSSEVAGIQQHGLQQQDISQQNFLTENIIPENSVVPPEY
TTNHNQQPLRNAAEKGMQASDILLAKAWFHCTQPMTRSRSSELRRRYAAMQSNLAPIVTG
THKATDQLRLDFTNVNSANSTPRGNTPIQTPTFISPSCSSTSPLDSPHMVAQDTVTSVVS
MLKDTLERKKLGSPANRDASHGSSFGFYDNQQFQHNILGGTNIFPLVTTAHAQDSLMLPE
VERPMEPNTGNFVAPTNQVWISAVSREPSQSGSSTAMTAQSAGFEVCDELPPMGQALSVC
ESTRRNAANGTSDCRSTGKDYRERVLKDNLKDDRKKVSLTRMGSISSEQAVDKGDPTKKR
RVERTRKMAEAKERSSTPVIPSDMQAVLKRCDNLEKEVRSLKLNLSFMNRKDSEQTKQIE
DLQKQNEDLAEEKERLLEEIERIASDSTT
Download sequence
Identical sequences I1H1G4
EG:BRADI1G50560.1 15368.BRADI1G50560.1 XP_003557170.1.954 XP_010228079.1.954 XP_014752363.1.954 XP_014752364.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]