SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G50627.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G50627.2
Domain Number 1 Region: 231-418
Classification Level Classification E-value
Superfamily Bet v1-like 3.85e-40
Family STAR domain 0.0028
Further Details:      
 
Domain Number 2 Region: 53-163
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000631
Family Pleckstrin-homology domain (PH domain) 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G50627.2   Gene: BRADI1G50627   Transcript: BRADI1G50627.2
Sequence length 757
Comment pep:novel chromosome:Brachy1.0:1:49202453:49210072:1 gene:BRADI1G50627 transcript:BRADI1G50627.2
Sequence
MLSSSASRREAARSCELGRTYGGEPPRPSPAAKARSGELLKGAAAGATAAAAAVRHEGWM
VRYGRRKIGRSFFHTRYFVLDNKLLAYYKKQPKDNMVPLKALVIDGNCRVEDRGLKTHHG
QMVYVLCVYNKKEKDNPITMGAHDIEGALAWKKKIELLIDQQQDTMTAKNRKAFASLDFD
MDLGGPLSFSDHDSGQAFLILFFLRVGLPDSVHDWTKEPDIGLSNQNDTNQVNSRKNWRL
LTCQNGLRIFEELVEVEYLARSCSRAMRAVGVVEATCEAIFGLIMSMDVTRYEWDCSFQY
GSLVEEVDGHTAILYHRLQLNWCSMLVWPRDLCYVRYWRRNDDGSYVVLFRSTEHQNCGP
QPGFARASIESGGFKISPLKSVNGRPRTQVQHLMQIDLKGWGVNYVTSFQYHSLLQMLNC
VAGLREYFSQTDDIQTVPRIPVMTTMANAPSVKTDKKRQEADSKTKQGDSAQADTENSDM
IDEESEEDDDCQVPETSLEEDNAKFDSDTKCSDPIDLSCFSGIIRQDTNEKSRNCWAVPD
SKIFKVRSKNFSRDKSKVSAGKYLMELVAVDWFKDNTRMDHVANRKGCAAQVAAEKGMFS
FVVNIQIPGSSHYSLVLYFVTRSLKKGSLLQRFADGDDDFRNSRLKLIPSVPKGSWIVRQ
SVGSTPCLLGKAVDCSYIRGPEYMEVDVDIGSSAVANGVLGLVFGVVTSLVVDMAFLIQA
NTYDELPEQLLGAARFSHIEPSAAVVPKLDNISPAGG
Download sequence
Identical sequences I1H1H4
EG:BRADI1G50627.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]