SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G51250.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G51250.1
Domain Number 1 Region: 434-729
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-61
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 763-833
Classification Level Classification E-value
Superfamily RING/U-box 8.3e-24
Family U-box 0.0039
Further Details:      
 
Domain Number 3 Region: 19-153
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.000000000000603
Family N-type ATP pyrophosphatases 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G51250.1   Gene: BRADI1G51250   Transcript: BRADI1G51250.1
Sequence length 836
Comment pep:novel chromosome:Brachy1.0:1:49698742:49703166:1 gene:BRADI1G51250 transcript:BRADI1G51250.1
Sequence
MEIEEDDAGGGGEAAGVSTVAIAVSGSKSSRHALKWALDKFVPGGRVLFRILHVRPPITM
VPTPMGNFIPISQVREDVASAYCEELEWRARNMLLPFKKMCAQRQVEAEAVLIESNDVPS
AISEEIDKFNICKLVLGSSSKGIFRRKLKGSKTASRICECIPSFCTAYVVAKGKLSFVHS
ATSDASETPRSISSLTVSSPSTRSVSSTTPSEWVDTNGTASFDRPSLSSQRDQAVANINR
LSNRGANPSGRAGSEISYHDDTDLMRNSHSIESEAHFSSRSSSSSSWNSVYKSFRRDSFP
DSSDLHAVVSENAPNLKHSGDQDGLKLEIERMKLKLQHLQKLHENAHNESVDSTQKVDNN
LGIRRFEDEVKLKEIDLTEEMVRRLVTRMERHEQGVDRTEVEPKQGSSEREATDSSNGDA
GEKRIGETIVGRCFTKYNRYSWEQIQASTSSFSSDLMIGKGSYGTVYKAKFQHTVAAVKV
LNSHDGCGTQQLQQELEVLGKIRHPHLLLMLGACPEHGCLVYEYMENGSLDDVLLHRRRR
DSSSAPPLAWFDRFRIAWEVAAAVLFLHSAQPDPIIHRDLKPGNILLDRNLAAKVGDAGL
STALQLPSAADVAGGGGTMVKHTAPVGTFCYIDPEYQRTGAVSAKSDVYALGVVLLQLLT
GRPPMGLAHAVETALDLDLEATGGGSSSAFAEMLDAAAGEWPLEEARELAALALRCAEMR
RRDRPGLREHVLPALERMKDLAAKAAAAAAREKNTALVLGSSTPTPSHFLCPILQEVMAD
PCVASDGYTYDRKAIEVWLGMNTKSPMTNLKLQSRSLIPNHSLRSAIMDWRTSRSR
Download sequence
Identical sequences I1H1Q2
XP_003557213.1.954 15368.BRADI1G51250.1 EG:BRADI1G51250.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]