SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G52260.8 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G52260.8
Domain Number 1 Region: 299-526
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 1.33e-78
Family CAT-like 0.0000246
Further Details:      
 
Domain Number 2 Region: 119-215
Classification Level Classification E-value
Superfamily Single hybrid motif 1.44e-26
Family Biotinyl/lipoyl-carrier proteins and domains 0.0000803
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G52260.8
Domain Number - Region: 251-284
Classification Level Classification E-value
Superfamily Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.00288
Family Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G52260.8   Gene: BRADI1G52260   Transcript: BRADI1G52260.8
Sequence length 526
Comment pep:novel chromosome:Brachy1.0:1:50620496:50625510:-1 gene:BRADI1G52260 transcript:BRADI1G52260.8
Sequence
MALLLRHSRKLRRVHGVLDCERGSIARHFSASACSTTLKKEDGVSNSSLEYGKKAGSLSI
SQDRKSGKDTHKFKVSPQEARGLYSSNRVLISATGVNSLFSCGQVVLARHFSSAADLPAH
EEIGMPSLSPTMTEGNIARWVKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIVCG
DGAKEIKVGEIIAITVEEEGDIEKFKDYKAPASSAAPAESKPQSESTEPKGEEKELPKAA
EPKATKTEESSHSGDRVFSSPIARKLAEDNNVPLSSLKASEAKGTKKEAAAAPGLGHVDL
PNSQIRKVTANRLLKSKQTIPHYYLTVDSRVDELIKLRSELNPLQDASGGKKISINDLVI
KAAALALRKVPECNSSWMNDFIRQYHNVNINVAVQTEHGLFVPVVRDADKKGLATIADEV
KQLALRARDNSLKPEDYEGGTFTVSNLGGPFGIKQFCAIVNPPQAAILAIGSAEKRVIPG
TDGQFEVGSFMSATLSCDHRVIDGAIGAEWLKAFKGYLENPTTMLL
Download sequence
Identical sequences I1H229
EG:BRADI1G52260.8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]