SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G54280.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G54280.1
Domain Number 1 Region: 80-404
Classification Level Classification E-value
Superfamily RNI-like 7.85e-63
Family Cyclin A/CDK2-associated p19, Skp2 0.027
Further Details:      
 
Domain Number 2 Region: 571-853
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.96e-51
Family Protein kinases, catalytic subunit 0.00086
Further Details:      
 
Domain Number 3 Region: 396-472
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 0.00000000000131
Family Outer arm dynein light chain 1 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G54280.1   Gene: BRADI1G54280   Transcript: BRADI1G54280.1
Sequence length 859
Comment pep:novel chromosome:Brachy1.0:1:52668377:52671538:1 gene:BRADI1G54280 transcript:BRADI1G54280.1
Sequence
MPPPSPSPCPRRCLFFSLLSASFLALGADGAGGGAGDGGDAAAMQALRRGLAPPDWAAAD
HCSWRGVTCGDGGAGAVTAIDLPRRGLRGDFSAAAGLRALARLDLSFNALAGGVPAALGA
LARLELLDLSMNKLSGPIPPALGRAVGLKFLNLSNNALSGAIPDELKALKGLQEVQISGN
NLTGAIPAWLAGLPGLRVLSAYENALSGPIPPGLGLSSKLQVLNLHSNGLEGSIPSSVFD
LGCVIRNLTYFEADSNQLSGAIPAQFARCANLTLLNLAYNRLVGEVPDMLGELRNLQELI
ISGNGLGGEFPRSVLRCRNLSKLDLSYNAFRGGLPETICNGSRMQFLVLDHNEFSGSIPR
GIAGCSRLLELQLANNNLSGEIPAEMGKIKSLQIALNLSFNHLSGPLPRELGRLDKLVAL
DLSSNQISGEIPGDMRGMMSLIVVNLSNNRLRGAIPVFGPFQKSSGSSFSGNAKLCGDPL
DVDCGSIYGSNYGLDHRKVSSRVALAVVGSCVLIFSVVSLVVTLFMWRERQEKEADAKKA
NAGEVIVEAPQVMASSVFIESLQQAIDFQSCVKATFKDANALRSGTFSTTYKAVMPSGMV
VCVKKLKSVDRAVIHHQSKMIRELERLAHMNHPNLVRPIGYVIYEDVALLLQYHMPNGTL
LQLLHNSNNCDSDIQKPDWPKLLSIAIDVAEGLAFLHQVATIHLDISSGNVFLDSHYNGL
LGEVEISKLLDPSKGTASISAVAGTFGYIPPEYAYTMQVTVPGNVYSFGVLLLEILTSKM
PVDEEFGEGVDLVKWVHSAPARGETPEQIMDPRLSTVSFVWRRQMLAVLKVAMLCTERAP
AKRPKMKKAVEMLQEAKNS
Download sequence
Identical sequences I1H2Q2
15368.BRADI1G54280.1 EG:BRADI1G54280.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]