SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G55380.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI1G55380.1
Domain Number - Region: 69-225
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 0.0811
Family DNA repair protein MutS, domain III 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G55380.1   Gene: BRADI1G55380   Transcript: BRADI1G55380.1
Sequence length 230
Comment pep:novel chromosome:Brachy1.0:1:53828199:53830332:1 gene:BRADI1G55380 transcript:BRADI1G55380.1
Sequence
MEAVKSLLKPKPTPQQQLREWQRRLRNEGRNIERQIRDVQKEEKKVEKAIREAAKRDDIG
SAKALAKEVVRSRKAVNRLYENKAQLNSISMHLGEIVATTRTVGHLSKSTEVMKLVNNLM
KAPEVAATMQEFSKEMTKAGVMEEMVNDAVDSALDNEDIEEEIEEEVDKVLSAIAGETAS
ELPDAVRKQKQKVTQPSTSEPVERTAVAEAVHDDDDELDKIRERLAKVRS
Download sequence
Identical sequences I1H324
EG:BRADI1G55380.1 XP_003557475.1.954 15368.BRADI1G55380.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]