SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G56540.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G56540.2
Domain Number 1 Region: 475-765
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.1e-42
Family Protein kinases, catalytic subunit 0.0005
Further Details:      
 
Domain Number 2 Region: 106-351
Classification Level Classification E-value
Superfamily RNI-like 7.85e-40
Family Rna1p (RanGAP1), N-terminal domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G56540.2   Gene: BRADI1G56540   Transcript: BRADI1G56540.2
Sequence length 797
Comment pep:novel chromosome:Brachy1.0:1:55134891:55138935:-1 gene:BRADI1G56540 transcript:BRADI1G56540.2
Sequence
MGGTHALLLLLSVAAAALAALAPGATALQASQAWSLLKLRQLLGDPPALSSWRNSTDFCY
GGDYKTASAFVECYDDSVTQLHIIGDPSAGAARPLPKTFSIDAFFTTLSRLPDLKVLTLT
NLGLWGPLPGNKISRLASLEIVNVSSNYLYGELPRGLSRLPNLQTLVADNNMLSGGFPDW
LSGGEKLPLLAVLSLRNNSLSGTLPESVVKAMPSLRTLVLASNNISGNLPDLSALEHLQV
VDMAGNSLGPEFPRLGRKVASVVLAGNRFSDALPEELLASCYLLERLDISSNRFVGPFPP
ALLSLPSIEYLSIAGNRFTGKLSGNASCGENLRFVDLSSNLLTGSLPACLAARNKDSGSM
TVLFSANCLSADGKDDSQHPSPFCQNQALAVGIVPEKAHKKPGAKGGLVAAIVAAVLGGA
LVVGAAIFFAVRKASTPKARPPRRLLEHASSAYPSNLFADARYISQTVKLGALGIPAYRS
FSLVELEAATDNFEVSSLMGQDAHGQMYRGRLSNGTPVTIRTLKVKKSQSSQSFNRHIEM
ISKLRHRHLVSALGHCFEYNLDDSTVTQLYLVFEYVQNGNLRGRISQGTEGRRLTWGQRI
STTIGVAKGIQFLHGGIIPGLFANNLKITNILLDQNQVAKIGSYNIPILSETTTKSEGGA
GNKYASDRVPNGDKIDIYDFGVILLEVISGKPISSIYEVEIMKEQLQSALTAEGPSRRRS
FVDPAVSKGCSDESMRTVMEICLRCLAKEAKQRPSVEDVLWNLQFAAQVQGDWRGDSRSS
EESPLSPSKVPAESADY
Download sequence
Identical sequences I1H3E8
XP_003557543.1.954 XP_010228322.1.954 15368.BRADI1G56540.3 EG:BRADI1G56540.2 EG:BRADI1G56540.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]