SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G56667.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G56667.1
Domain Number 1 Region: 755-1376
Classification Level Classification E-value
Superfamily Molybdenum cofactor-binding domain 2.22e-154
Family Molybdenum cofactor-binding domain 0.00000000599
Further Details:      
 
Domain Number 2 Region: 210-421
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.53e-36
Family CO dehydrogenase flavoprotein N-terminal domain-like 0.0012
Further Details:      
 
Domain Number 3 Region: 618-752
Classification Level Classification E-value
Superfamily CO dehydrogenase molybdoprotein N-domain-like 1.44e-31
Family CO dehydrogenase molybdoprotein N-domain-like 0.00038
Further Details:      
 
Domain Number 4 Region: 109-203
Classification Level Classification E-value
Superfamily CO dehydrogenase ISP C-domain like 1.23e-27
Family CO dehydrogenase ISP C-domain like 0.00041
Further Details:      
 
Domain Number 5 Region: 13-102
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.75e-18
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.00043
Further Details:      
 
Domain Number 6 Region: 447-556
Classification Level Classification E-value
Superfamily CO dehydrogenase flavoprotein C-terminal domain-like 0.0000000000000366
Family CO dehydrogenase flavoprotein C-terminal domain-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G56667.1   Gene: BRADI1G56667   Transcript: BRADI1G56667.1
Sequence length 1391
Comment pep:novel chromosome:Brachy1.0:1:55281689:55290642:1 gene:BRADI1G56667 transcript:BRADI1G56667.1
Sequence
MASSPQPASAAAVVFAVNGERFELRDGDGVDPGATLLDFLRSRTRFTGPKLGCGEGGCGA
CVVLLSTYDPAADEVSHAAATSCLTLARGLHHRAVTTTEGLGNSRDGLHAVHARLAGFHA
SQCGFCTPGMCMSLAAALAGSKGPGPPPREGFSRLTSAEAERAIAGNLCRCTGYRPIADA
CKSFAADVDLEDLGLNSFWKKGDTNVSKLPPYKEGSIGTFPEFLKAEIIASSRIDKCTLT
PATAGSASSWFRPRSVEGYYKLIDSDPFNGSGTKVVAGNTSSGVYREAEVYGRYIDLRDI
PELNSVCMDAKGVRIGAAIPISWVIDILREGDDCKDVVFGKIADHMEKVASHSVRNTASL
GGNLVMAQRDEFPSDIATILLAAGSSVCIQVSSQKRNVMLDEFLEMPPCDYKTLLLNIYI
PRCTPDSVLSSAGTVNIAGDKTGSSLLFETYRGAQRPLGNAIAYLNSAFFAQVSSDKTSG
SLILENLRLAFGAYGTQHAIRARDVEKLLVGKPINASVLLEAFKVLKKTIVPIEGTRHSA
YRSSLAVAFLFSFLYPAIKGNVKPTKAVHLNGNVASGTNGMPNCGPSANVDVSLNGTNSV
KSGLYSNAHILESCKQIVEISKDYLPVGIPTKKVGAELQASGEAVYVDDIPSPEDCLYGA
FVYSTKPLAHVKSIELDSSLEQLKTVAVITVKDIPKGGGNFGANTIFGPEPLFGDPLTQC
AGEPLGVVVAETRNFANIAAKRALVNYSTETLDTPILSIEEAVRRHSYFETPPFLLPQKI
GDFPKGMEEADQKIYSAEVKLNSQYYFYMETQTALAIPDEDNCMVVYSSSQCPEAAQNNI
AQCLGLPCHNIRVVTRRVGGGFGGKAVRSLPVATACALAAFKLRRPVRMYLDRKTDMIMT
GGRHPMKICYSIGFKSDGRITGLHVDLFINAGMSMDVSPIIPHNFVEALKKYNWGAFSYD
AKICKTNIATRSAMRGPGEVQGSYVAEAIIEHVASALSTDVNLVRQRNIHTVESLALYHG
ECMEDALGYTLPSICNKLTASTNYQYRLEMIQTFNKSNQWKKRGLSFVPIVHKVSSRPTP
GKVSILNDGSIVVEVGGIELGQGLWTKVKQMAAFGLGQLWDDQSQDLLERVRVIQADTLS
VVQGGWTTGSTTSECSCEAVRRACNIMVDRLKSLKEQLQEKQGMVSWDGLISQAKMAGVD
LSAREYYIPGASGSYLNYGAAASEVEIDLLTGATTILRSDLIYDCGQSLNPAVDLGQVEG
AFVQGIGYFMSEEYVTNSDGLIVSDGTWTYKIPTVDTIPKQFNVELLNSGFHKKRVLSSK
ASGEPPLLLAASVHCATREAIAAARKEYCSGSGSSSPPFFELEVPAVMPVVKELCGFENV
EKYLETLLASE
Download sequence
Identical sequences I1H3G5
XP_010228335.1.954 XP_014752258.1.954 EG:BRADI1G56667.1 EG:BRADI1G56667.2 EG:BRADI1G56667.3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]