SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G57900.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G57900.1
Domain Number 1 Region: 683-961
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.8e-77
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 67-378
Classification Level Classification E-value
Superfamily RNI-like 1.41e-60
Family 28-residue LRR 0.068
Further Details:      
 
Domain Number 3 Region: 300-615
Classification Level Classification E-value
Superfamily L domain-like 8.67e-55
Family Polygalacturonase inhibiting protein PGIP 0.00093
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G57900.1
Domain Number - Region: 644-702
Classification Level Classification E-value
Superfamily Nqo1 FMN-binding domain-like 0.0405
Family Nqo1 FMN-binding domain-like 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G57900.1   Gene: BRADI1G57900   Transcript: BRADI1G57900.1
Sequence length 1019
Comment pep:novel chromosome:Brachy1.0:1:56697156:56700983:-1 gene:BRADI1G57900 transcript:BRADI1G57900.1
Sequence
MLLPLVLLLAALAAIDPASGSDADALLAAKAALDDPTGALASWTSTSPNPCAWSGVSCAA
GSNSVVSLDLSGRNLSGRIPPSLSSLPALILLDLAANALSGPIPAQLSRLRRLASLNLSS
NALSGSFPPQLSRRLRALKVLDLYNNNLTGPLPVEIAAGTMPELSHVHLGGNFFSGAIPA
AYGRLGKNLRYLAVSGNELSGNLPPELGNLTSLRELYIGYYNSYSGGIPKEFGNMTELVR
FDAANCGLSGEIPPELGRLAKLDTLFLQVNGLTDAIPMELGNLGSLSSLDLSNNELSGEI
PPSFAELKNLTLFNLFRNKLRGNIPEFVGDLPGLEVLQLWENNFTGGIPRHLGRNGRFQL
LDLSSNRLTGTLPPELCAGGKLHTLIALGNSLFGAIPESLGECRSLARVRLGENFLNGSI
PEGLFQLPNLTQVELQGNLLSGGFPAMAGASNLGGIILSNNQLTGALPASIGSFSGLQKL
LLDQNAFSGPIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDVSRNNLSAEIP
PAISGMRILNYLNLSRNHLEGEIPATIAAMQSLTAVDFSYNNLSGLVPATGQFSYFNATS
FLGNPGLCGPYLGPCHSGSAGADHGGRTHGGLSSTLKLIIVLVLLAFSIVFAAMAILKAR
SLKKASEARAWKLTAFQRLEFTCDDVLDSLKEENIIGKGGAGTVYKGTMRDGEHVAVKRL
STMSRGSSHDHGFSAEIQTLGSIRHRYIVRLLGFCSNNETNLLVYEYMPNGSLGELLHGK
KGCHLHWDTRYKIAVEAAKGLCYLHHDCSPPILHRDVKSNNILLDSDFEAHVADFGLAKF
LQDSGTSECMSAIAGSYGYIAPEYAYTLKVDEKSDVYSFGVVLLELITGKKPVGEFGDGV
DIVQWIKMMTDSSKERVIKIMDPRLSTVPVHEVMHVFYVALLCVEEQSVQRPTMREVVQI
LSEPPKLIPKQGEELPGSGEGDELDPAIPAETVESVSNEAQEQQQLSPKSSLPPNLISI
Download sequence
Identical sequences I1H3V9
EG:BRADI1G57900.1 15368.BRADI1G57900.1 XP_003557615.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]