SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G58050.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G58050.1
Domain Number 1 Region: 31-130
Classification Level Classification E-value
Superfamily PH domain-like 3.36e-17
Family Pleckstrin-homology domain (PH domain) 0.0048
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G58050.1
Domain Number - Region: 205-264
Classification Level Classification E-value
Superfamily Peptide deformylase 0.0181
Family Peptide deformylase 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G58050.1   Gene: BRADI1G58050   Transcript: BRADI1G58050.1
Sequence length 483
Comment pep:novel chromosome:Brachy1.0:1:56913528:56918502:1 gene:BRADI1G58050 transcript:BRADI1G58050.1
Sequence
MASHGSSTTVGEMESSLERVRRQLSSTSSRHILQGPLLKRSDTLRKWNERWIILDPATGK
MEYKVCRSDTGVRGVIVFDSTSTVTLSPTNFHGLPKYEGCCFYIGTPQKKEYFLCAETPS
AARAWVSTLHATQLVLQAHKQAVNSLGGNGSAKLGTVATVVAVANSTAIEASKEVEAAMK
ISLRAALGSTTNKLTKGQLDDLTIMMETLRVKDDELHQLLQDIRARDSTIREITDKLQET
AEAAETAASAAHSIDEGRRILSSELERLKKDQENQVELSLLRLKESEEKAKLLAEEREHL
LKERDSALQEAQMWRSELGKARGNAVILEAAVVRAEEKARISAADAGMRIKEAMSRLESC
TKEKEELLILVDTLRSQIQRQETNTKQVREERSDLCSTSKHMDMEDDNVDKACLSDTDLI
PITENIVDLDDEGVDIRTIGDTEWENPHSSEVSDVREVTTEPEESSLDIPVDSQPVSENT
FQG
Download sequence
Identical sequences I1H3X7
EG:BRADI1G58050.1 15368.BRADI1G58050.1 XP_003557623.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]