SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G58930.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G58930.1
Domain Number 1 Region: 25-291
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-53
Family Protein kinases, catalytic subunit 0.00076
Further Details:      
 
Domain Number 2 Region: 333-529
Classification Level Classification E-value
Superfamily Ribonuclease H-like 1.95e-21
Family DnaQ-like 3'-5' exonuclease 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G58930.1   Gene: BRADI1G58930   Transcript: BRADI1G58930.1
Sequence length 546
Comment pep:novel chromosome:Brachy1.0:1:58032650:58036739:-1 gene:BRADI1G58930 transcript:BRADI1G58930.1
Sequence
MDRQSTIGPSDLEHMLLDESVEPRELPLSLLENITGGFSCDQEIGSGGFAVVYKGTLPNR
LVAVKKLINLHAYENKFTQEVGCLTKAKHKNIVRFLGYCADTQGQVKNMDNNFVLAELRE
RLLCFEYLPGSLDVYIKDISNGLQWKKSYQIIKGICEGLHYLHENHIAHLDMKPSNILLD
DNKEPKIADFGLSRWFGENKTRTITSSLVGTLLGVIISEILTGKKHHDEIDEVFESWRNM
VDIRENQLEQIRVCAEIGKECRDNNPKRRPSTQNILDRLVKMERTRWSTETSGSTSSVTT
ADRFCNASPCQRPVFKEQRHDLGDGKHINITGLLDYFVVVDFKATCEKGLMFNPQEIIEF
SSVLVDPVTGNSESPPFHSYLRPQERPVLTDFCREYNGIQQTDVDKGIVLAEALPKHEAW
LKEAETKKGRALRFAIVTWGDWDCRSMLDRECRHKGVASPQYFHQWIDLKIPFMDKFGRE
YIPGSALKALTEAGLLWEGRRNGGFYNAHNKARLLGFLVQQGVQFSITSKLEQKPAPKLL
YSVLQG
Download sequence
Identical sequences I1H492
EG:BRADI1G58930.1 15368.BRADI1G58930.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]