SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G60460.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G60460.2
Domain Number 1 Region: 607-779
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 4.58e-22
Family hypothetical RNA methyltransferase 0.051
Further Details:      
 
Domain Number 2 Region: 406-441
Classification Level Classification E-value
Superfamily WW domain 0.0000325
Family WW domain 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G60460.2   Gene: BRADI1G60460   Transcript: BRADI1G60460.2
Sequence length 823
Comment pep:novel chromosome:Brachy1.0:1:59823274:59832981:-1 gene:BRADI1G60460 transcript:BRADI1G60460.2
Sequence
MLQFAQPSRSADLLPPRASAATHHAAECRAPEPSRPFLLPSPHERIPPFRSPFHNLPQFV
TGKNQGRAATLPCPTGSSARGDAGGGGVFGDKEAGAALQAQRSAPLVIPLSLSESFSGLV
FVSEHFVPYIVIRCRDDSYVTGASETQDWYAAETGCPGSQIAKTRNRAAKQTDEDPSFVE
DMELVSLMGSLGLPVSFSTRKEKKNIAIKGKHQGRQAPCEELNTSTVDDARTCENTEELE
GAQELMGCMEHTNSGISSMTAVGYNEVYHADADKMLGEDMVYVEKSGFVTACSVEKIPRD
EAHNECEPNDNTSNLVESSSPVQENQAAGSVVQLNKVMLGQNSVTNESMMSCTDDCQRGK
SSVREDQISWETPSVSHDNDVDCEVCPCPAEPSPVNNHVEKSASDFNYEHGDWKVLWDQF
YSQYYFFNIMTQVSTWYPPQGLEDFASYCSTYPSQGLDEPSLQYTSTSVQEHNKSSTKCD
KSSGLVCWADNTMDNYISEADRHVVQYEAHMSSCDNGGTTFDQAGVGRHLNHQVHDLYSD
APNLSDVPDEESMCLSAITTIDEAQHDESEQNGSLVTEALEVSQEVTTTKNKKRVRRSQS
YRSCQDLADNISTDIAKYWNQRYSLFSLFDSGIKMDEEGWFSVTPEPIAKHHASRVSAGI
VIDCFTGVGGNTIQFATKCKHVVAVDIDPQKICCAQHNATVYGVNDHIDFVVGDFIHISP
HLKGDTAFMSPPWGGPDYAKVDVYDIKTMLKPCDGYQLFKLATAIASRVVMFLPRNIDLN
QLADMCLSVDPPWSVEVEKNFLNGKLKAITAYFEEQDHADASN
Download sequence
Identical sequences I1H4S7
EG:BRADI1G60460.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]