SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G60756.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G60756.1
Domain Number 1 Region: 89-206
Classification Level Classification E-value
Superfamily Caspase-like 0.00000837
Family Caspase catalytic domain 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G60756.1   Gene: BRADI1G60756   Transcript: BRADI1G60756.1
Sequence length 383
Comment pep:novel chromosome:Brachy1.0:1:60156541:60158307:1 gene:BRADI1G60756 transcript:BRADI1G60756.1
Sequence
MASARARHARTTWCRHCGASLSAAASARSVRCALCHAETRVERRPQHQGGLHQAMGFIKG
LFNNAFGSASATSQPPPSSSESMRAGDAYGLPASYPRDRSSKKRALLVGISYAFTKYELK
GSVNDVNCMRYLLRDKFNFPTDCILTLTPDEKDPYRVPTKDNLRLAMRWLVEGCTSGDSL
VFHFSGHGVQKLDNNGDEMDGYDEALCPQDFEDRGVILDDEINETIVRPLGPGVKLHAII
DTCHSGTILDLPYLCRISRTGYWQWESQARQQETPKGTNGGIAISFSGCGDSQNSADTTS
FSGSASTGAMTYSFIKAVLSEPGPTYGRLLSAMRATIRDNGGECGIPGPIGSFFRRVITF
SCAQEPQLCASETFDIYRKPFLL
Download sequence
Identical sequences I1H4W4
EG:BRADI1G60756.1 XP_003557789.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]