SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G60762.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI1G60762.1
Domain Number - Region: 86-227
Classification Level Classification E-value
Superfamily Caspase-like 0.00398
Family Caspase catalytic domain 0.069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G60762.1   Gene: BRADI1G60762   Transcript: BRADI1G60762.1
Sequence length 369
Comment pep:novel chromosome:Brachy1.0:1:60160425:60162359:1 gene:BRADI1G60762 transcript:BRADI1G60762.1
Sequence
MGNTGPPRTRTRPWCSHCGAGLVVPPAGAGAGSSSVRCALCHRVTRIERQYRSVGGNSML
SAPSVDRRELPAAGAAAGYPVARGNKRAVLVGVSYTGTDYELKGTVNDVNSMRGLLCDKF
GFPSDCILILTEKSDDPRRVPTKENLLAAMRWLVAGCEAGHSLVFHFSGHGVQKLDTDGD
EVDGYNEALCPLDFEDKGKILDDEINETIVRPLVQGVKLHAIIDTCHSGTILDLPYLCRM
SRTGYWQWENHTRRPDKCKGTKGGLAISISGCNDDQKSADSSGFSDQSASIGAMTDSFIK
AVGSEPGTTYGRLLSAMRSTIRDGQGSGRRLLTGRFGSFVRNMIASSSVQEPQLCSSEAF
DIYRKPFLL
Download sequence
Identical sequences I1H4W5
EG:BRADI1G60762.1 XP_003561579.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]