SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G61450.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G61450.1
Domain Number 1 Region: 469-661
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-42
Family Protein kinases, catalytic subunit 0.002
Further Details:      
 
Domain Number 2 Region: 725-793
Classification Level Classification E-value
Superfamily RING/U-box 2.3e-17
Family U-box 0.0043
Further Details:      
 
Domain Number 3 Region: 49-153
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000184
Family Universal stress protein-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G61450.1   Gene: BRADI1G61450   Transcript: BRADI1G61450.1
Sequence length 794
Comment pep:novel chromosome:Brachy1.0:1:60837058:60841216:-1 gene:BRADI1G61450 transcript:BRADI1G61450.1
Sequence
MEILSPSPPPSPAASQFLYGGGPLHAGLRRDHAHALLHIAVGRSPEKTLPLLRWAFRRFA
CARVVLLHVHQPSHAIPTLLGKIPAAQATEELVLSHRMSEKDEMNKILRTYLTFCRRAQV
QPSLLVTESDQIHDGIVTLVKDHGVTKLVMGSIPDNCFKLKPSHSKEYFMAKNAPAFCEI
WFVWRGRHIWTREASAAIDNSISVYNQDDIMMTVRRTRFSSNSNDAGSMFDDGYNTCGTS
TVADLHEVTIFNNGRLNDYGSLGADANCIDNMNISNLQDAESAFNSPPCPDSSLHGVALQ
LYSKEMLDTNLRKVIIEAEGSRKEAFLELLKRKETELNVANAFARVKASECSKKLELKRR
EELEGLFLATRKQHEDLARSREKAAAVLDSSMRRLDILDAHAKSISERMNDAVAELEVIQ
SSIKILKQEKTKVQKLEDRHINQIEGCTYSHYKLPNCSSVALGDDSYTFRKSTLLDKQAA
TCKFSESFKIRPQGHGCVYKGENMNRGVMIHKLHSHRIKSLMLFEQEVRILSKVRHPHLV
TLVGACPDTPCLVYEYLQNGSLHRCLFSEHNALSLPWKIRARIVAEISSALLFLHSCKPQ
MIVHGGLNLENILLDTDFHCKIVDFGISTGDPAGLLARKSDIYSFGIVILQLLTRKHPGL
SLATEVRSAMSCGKLSSILDPTAGKWPMEVARRLAEFGIKCSGDRLELTPEAVRDLEQLH
LMRGRQVPSFFLCPILKETMDDPQVAADGLTYEGRAIRDWMENGRAVTNLELKHLNLIPN
HALRFAIQDWLSQS
Download sequence
Identical sequences I1H547
XP_014752486.1.954 15368.BRADI1G61450.1 EG:BRADI1G61450.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]