SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G63080.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G63080.1
Domain Number 1 Region: 9-302
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.48e-94
Family Protein kinases, catalytic subunit 0.00000458
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G63080.1
Domain Number - Region: 342-422
Classification Level Classification E-value
Superfamily KA1-like 0.0183
Family Kinase associated domain 1, KA1 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G63080.1   Gene: BRADI1G63080   Transcript: BRADI1G63080.1
Sequence length 447
Comment pep:novel chromosome:Brachy1.0:1:62283621:62286613:-1 gene:BRADI1G63080 transcript:BRADI1G63080.1
Sequence
MPEQKGNILMQRYEMGRLLGQGSFAKVYYGRDVNTSQSVAIKVIDKEKIFKCGLMDQVRR
EISVMKLVKHPNIVQLYEVMATKTKIYFVLEYVKGGELFNKVQRGRLKEDVARKYFQQLN
SAVDFCHSRGVYHRDLKPENLLLDEDRNLKISDFGLSALAECKRQDGLLHTTCGTPAYVA
PELISKKGYDGAKADIWACGVILYVLLAGYLPFQDKNLMDMYKKIYKAELKWPSWFSSDA
RRLLRRILDPNPATRISFSEIMENPWFTTGLNSELLNYSIPTENVVHVDMDPASDPFNNN
TTDDGKEETGKVTNLNAFDIIALSSGFDLSGMFGDNCNKESKFTSTNTAITIIRKLEDIA
KSLRLKLIKKDGGLLKMESLQPGRKGAMSINTEIFQFTPNFHLVEIKKINGDTLEYQNVM
KQSMRPALKDIVWAWQGEQPQQQNEPC
Download sequence
Identical sequences I1H5Q0
15368.BRADI1G63080.1 EG:BRADI1G63080.1 XP_003557957.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]