SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G63200.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G63200.1
Domain Number 1 Region: 690-957
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.04e-68
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 51-376
Classification Level Classification E-value
Superfamily L domain-like 9.52e-65
Family Polygalacturonase inhibiting protein PGIP 0.0017
Further Details:      
 
Domain Number 3 Region: 307-566
Classification Level Classification E-value
Superfamily RNI-like 1.96e-45
Family Cyclin A/CDK2-associated p19, Skp2 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G63200.1   Gene: BRADI1G63200   Transcript: BRADI1G63200.1
Sequence length 970
Comment pep:novel chromosome:Brachy1.0:1:62404119:62407890:-1 gene:BRADI1G63200 transcript:BRADI1G63200.1
Sequence
MHPLLLVLVHLVFLAEAKGAGRGAGSVAALNDDVLGLIVFKADVVDPEGRLATWSEDDER
ACAWAGVTCDPRTSRVSGLSLDGFGLSGKLGRGLLRLESLQSLSLSRNNFSGDLPADLAR
LPDLQSLDLSSNAFSGAVPDGFFGKCHSLRDVSLANNAFSGGIPDVGGCATLASLNMSSN
RLAGTLPGGIWSLNALRTLDLSGNAITGDLPVGISKMFNLRALNLRSNRLTGSLPDDIGD
CPLLRSVNLRSNSLSGNLPESLRRLSSCTDLDLSSNELTGTVPTWIGEMASLEMLDLSGN
KFSGEIPESIGGLMSLRELRLSGNGFTGGLPESIGRCRSLVHVDVSWNSLTGSLPAWIFS
SGVQWVSVSDNTLSGEVLVPVNASSVIQGVDLSSNAFSGPIPSEISQLLTLQSLNISWNS
LSGSIPASIMEMKSLELLDLSANRLNGRIPATIGGKSLKVLRLGKNSLAGEIPVQIGDCS
ALASLDLSHNGLTGAIPATIANLTNLQTADLSRNKLTGGLPKQLSNLAHLIRFNVSHNQL
SGDLPPGSFFDTIPFSSVSDNPGLCGSKLNSSCPGVLPKPIVLNPDSSSNPLAQTEPVLE
GLRHKKTILSISALVAIGAAVLIAVGIITITVLNLRVRSPASHSAPVLELSDGYLSQSPT
TDVNAGKLVMFGGGNSEFSASTHALLNKDCELGRGGFGTVYKTTLRDGQPVAIKKLTVSS
LVKSQDEFEREVKMLGKLRHHNLVALKGYYWTPSLQLLIYEFVSGGNLHKLLHELSTVSC
LSWKERFDIVLGIARSLAHLHRHDIIHYNLKSSNIMLNGSGEAKVGDYGLAKLLPMLDRY
VLSSKVQSALGYMAPEFTCRTVKITDKCDVYGFGVLVLEVMTGKTPVEYMEDDVIVLCDV
VRAALDEGKVEECVDERLCGKFPLEEAVPIMKLGLVCTSQVPSNRPDMSEVVNILELIRC
PPDSPETELG
Download sequence
Identical sequences I1H5R6
XP_003557968.1.954 EG:BRADI1G63200.1 15368.BRADI1G63200.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]