SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G65630.4 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G65630.4
Domain Number 1 Region: 13-287
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.53e-98
Family Protein kinases, catalytic subunit 0.00000566
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G65630.4
Domain Number - Region: 326-395
Classification Level Classification E-value
Superfamily KA1-like 0.00549
Family Ssp2 C-terminal domain-like 0.06
Further Details:      
 
Domain Number - Region: 280-328
Classification Level Classification E-value
Superfamily UBA-like 0.0357
Family UBA domain 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G65630.4   Gene: BRADI1G65630   Transcript: BRADI1G65630.4
Sequence length 412
Comment pep:novel chromosome:Brachy1.0:1:64598702:64605203:-1 gene:BRADI1G65630 transcript:BRADI1G65630.4
Sequence
MDGNARGGGHSEALKNYNLGRTLGIGTFGKVKIAEHKHTGHKVAIKILNRRQMRTMEMEE
KAKREIKILRLFIHPHIIRLYEVIYTPTDIFVVMEYCKYGELFDCIVEKGRLQEDEARRI
FQQIISGVEYCHRNMVVHRDLKPENLLLDSKYNVKLADFGLSNVMHDGHFLKTSCGSPNY
AAPEVISGKLYAGPEVDVWSCGVILYALLCGSLPFDDDNIPNLFKKIKGGIYILPSHLSA
LARDLIPRMLVVDPMKRITIPEIREHNWFQNRLPRYLAVPPPDTAQQAKMIDEDTLQDVV
NLGYEKDHVCESLCNRLQNEATVAYYLLLDNRFRATSGYLGADYQESMDRSFNQFTSSEP
ASSSTRNYLPGSSDSQGSGLRPYYPVERKWALGLQVLHIIHFTSLCFVIFRY
Download sequence
Identical sequences I1H6L8
EG:BRADI1G65630.4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]