SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G65680.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G65680.1
Domain Number 1 Region: 109-379
Classification Level Classification E-value
Superfamily Pseudouridine synthase 2.67e-49
Family Pseudouridine synthase RsuA/RluD 0.00043
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G65680.1
Domain Number - Region: 67-96
Classification Level Classification E-value
Superfamily Alpha-L RNA-binding motif 0.0216
Family Pseudouridine synthase RsuA N-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G65680.1   Gene: BRADI1G65680   Transcript: BRADI1G65680.1
Sequence length 390
Comment pep:novel chromosome:Brachy1.0:1:64630421:64634934:-1 gene:BRADI1G65680 transcript:BRADI1G65680.1
Sequence
MAAAAGEAPLSQAIYSFGKPWPELNEGLSYTDTFRCAGPAADTSTTLIEFYSDNYKSSAP
LPGWIHRIRNGQITVDGQVVIDPEMILREGSKLVYHRLAWQEPLAPHMLQVLYEDDDIVA
LNKPSGLQVLPKGLFQQRTVLAQLQWKEWKMPLSSCSKRKNVQSHPVPVHRLGRGTSGLL
LCAKTKLAKVRLASYFAEGTINAGNKRDETEDSRERKVSKFYRALVTGILENDEDVVTQP
IGLVHYPGVSEGLYVACSSGKQAVSKVCVLERLAHENQTLVQVEIHSGRPHQIRIHLGYI
GHPLVDDPLYGIGGQPKFADLEHSCPDVSFAYDGGYERPLQPVPGDCGYHLHAHWLVLCH
PSTEKMVKITAPLPRILQTREERCAKQVDS
Download sequence
Identical sequences I1H6M3
15368.BRADI1G65680.1 XP_003561739.1.954 EG:BRADI1G65680.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]