SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G67687.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G67687.1
Domain Number 1 Region: 214-412
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.61e-27
Family BCR-homology GTPase activation domain (BH-domain) 0.0042
Further Details:      
 
Domain Number 2 Region: 51-160
Classification Level Classification E-value
Superfamily PH domain-like 4.46e-19
Family Pleckstrin-homology domain (PH domain) 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G67687.1   Gene: BRADI1G67687   Transcript: BRADI1G67687.1
Sequence length 858
Comment pep:novel chromosome:Brachy1.0:1:66278631:66294026:1 gene:BRADI1G67687 transcript:BRADI1G67687.1
Sequence
MSASEFRIPYQPVSSSQTSENAGQFKICKCGEGDPNSQTGEAGDSPPATCPNCQVLKSGH
LLLSSKGIGWTTWKKRWFILTRASLVFFRSDPNAPPRGNEPVVTLGGIDLNNSGSVVVKE
DRKLLTVLFPDGRDGRTFTLKAETTEELNEWRSALESALAQAPSVANTVGQNPIFSTDGT
EPSEASNEQSEDKSSVIGRPAEFALVDADGSASFLEKSLRFIEDYGKCFPYCCKVEGILR
QSADVEEVKRRFRDYEKGKNEFSPEEDGHVIGDCIKCILREMPGSPIPAACCTALVTAYR
SDKTKRLDALNKVIYEVFPEPNRQLLQRILKMMQVVESHKAVNRMSQSALAACMAPLLLR
PLLLGECEIDSDFSMAGDGSFQLLQAAAAANHAQAIVIIMLEEYDQIFDDLEEGSCSSDA
YTESDDGDVDKEYSSDNDNRDEDGSYDSGEDDIEEDLDDNTEHSSGGSERDKTNISGTAC
HDNDQVAQPPTKAARTERGVSREGIDKKSSVPQVEKESCESNASTDDIAKSNSRSSLRAK
FLEKSNSSANRSKRTLWGRTSARKDLSTEEVECCSDDEALIEKLENNKADLQSKISKEVK
ENVNLQASLEKRKEALHERRLTLEKEVENLRDLLQKERSLRVSLESGLMNMRRGQVSFPS
TIDSKTKADLEEVAAAEADVLNLKQKACDLRGQLSGQGQLSSTSLCESCNKRLLNADNLV
EEKQNAGLSPEISSSTEASSIVGLNSVSRMIPSAGMAEIVEQLRRQAAPNPSSSIGAQRL
LRQNSNSPQLNRLQGPNASSIRAEESGGAPPSAISKLTNRLNFLKERRALLASEMQNLDL
ARPPAPPPTAPAPNKDST
Download sequence
Identical sequences I1H7B2
EG:BRADI1G67687.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]