SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G68050.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI1G68050.1
Domain Number - Region: 45-102
Classification Level Classification E-value
Superfamily PH domain-like 0.0144
Family VPS36 N-terminal domain-like 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G68050.1   Gene: BRADI1G68050   Transcript: BRADI1G68050.1
Sequence length 230
Comment pep:novel chromosome:Brachy1.0:1:66585193:66588477:-1 gene:BRADI1G68050 transcript:BRADI1G68050.1
Sequence
MAPGLKRFTDVAGDGTPLLDGASGEELVRVERAASVALGPRAPEAPGTLFVTTRRVIWLS
EAEKGKGYSVDFLDITLHAVSRDPEAYPSPCLYTQLEAESGSDEDAGNLDSEALGDLQLA
KIAEMRIILSDASQLDSLFDVFCQCAGLNPDPNVDENEENSWFHGEDMADGGWIHGDEHM
ADAIDPEFFTANPIGQNDGYDLNSSVLELQINDQRFEDADEEQVPRENGH
Download sequence
Identical sequences I1H7F5
15368.BRADI1G68050.1 XP_003558347.1.954 EG:BRADI1G68050.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]