SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G69600.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G69600.1
Domain Number 1 Region: 502-799
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.04e-73
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 2 Region: 56-160,194-229
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.03e-23
Family alpha-D-mannose-specific plant lectins 0.0052
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G69600.1
Domain Number - Region: 385-428
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00392
Family Pan module (APPLE domain) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G69600.1   Gene: BRADI1G69600   Transcript: BRADI1G69600.1
Sequence length 844
Comment pep:novel chromosome:Brachy1.0:1:68106100:68108796:-1 gene:BRADI1G69600 transcript:BRADI1G69600.1
Sequence
MVLLLVFLLFSSSLQVSTTAIHTLALGQSLPWNETMVSKGGSFELGLFSPGNSSKHYIGI
WYKKISKRTVVWVANRENPVVNPSTSRFMLSVHGELALLTTPSDASLWSSSRPSSSPPPR
ATFATLQDDGNLVVWSSSRNATSTTTSSQVTWQSFDHPTDTWLPGARLGYDRGAGGGVHS
FLTSWTDSENPAPGAFTMEIDARGQPKFDLFAAAARGSGAKQQYWTTGLWDGEIFANVPE
MRSGYFAGIPYAPNASVNFFTYRDRIPAGSSAFRGVGIGNFMLDVNGQMRRRQWSEQAGE
WILFCSEPHDACDVYGSCGPFGLCSNTTSPACRCPSGFAPRSEREWSLRNTASGCARRSL
LECPKDGFLKLPYAVQLPGGSAEAAGVRNERDCERSCLKDCSCTAYVYDGAKCALWKSEL
VNMRTLSNDQSAGDRGLALHLRVARSDVPAASSSPAHSWKKSMVILGSVVAVVALLLGCL
VIVAVAAVVLRMRRGKGKVTAMQQGSLLVFDYRALRTATRNFSEKLGGGSFGTVFKGALP
DATVIAVKKLDGFRQGEKQFRAEVVTLGMVQHINLVRLRGFCSEGNKRALVYDYMPNGSL
DAYLFKAGSEDDAKKVLSWGQRHGVALGVAMGLAYLHEKCRECIIHCDIKPENILLDEEM
GAKLADFGMAKLVGRDFSRVLTTMRGTLGYLAPEWLAGGTVTAKADVYSFGLLLFELVSG
RRNNAPSSSSEEGGGHGMYFPVHAAVSLHGGDVVGLLDERLAKDADVKELERVCRVACWC
IQDEEGDRPTMGLVVQQLEGVADVELPPIPSRLHMLATVNPCAGGGAEDGFCSKGGSKLA
TAEV
Download sequence
Identical sequences I1H7Z0
XP_003558470.1.954 15368.BRADI1G69600.1 EG:BRADI1G69600.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]