SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G70950.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G70950.1
Domain Number 1 Region: 37-363
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.47e-71
Family Protein kinases, catalytic subunit 0.0000254
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G70950.1   Gene: BRADI1G70950   Transcript: BRADI1G70950.1
Sequence length 437
Comment pep:novel chromosome:Brachy1.0:1:69082744:69084057:-1 gene:BRADI1G70950 transcript:BRADI1G70950.1
Sequence
MAVLRKRPAAVLNGDHATATQESAKATRCKRSRVTVGSTDDYVDSTCIGAGGFGAVFRAR
HRVTGKIVAIKHLNSEGANAGELLREARFLQLCSGNPYVVGFEGLARDPRTGNLCFVMEY
VEAPSLNDFFWDTRHGPRLPEPTVRAFMWKLLTGAKMMHERHVVHRDIKPANILVGAAEQ
EGGGGDRLLKMCDLGLAISMTDAPPYNQAGTLNYMAPEMLLQKTDYDALVDTWSLGCVMA
ELVTGEALFDDEQEEDEDDDDERESESLTQLRSIFSVLGVPSEKSWPEFTSLPLAGEALR
ALPAMVRPHQSKLREMFPEETLSADGFKVLEGLLTCNPAKRLTAAAALKLPWFTPLRPAA
AAAAKINAPALPTKKPQKIKIIPPATPQKKPPTIKIIPPVIPEKKPTRIKIIPFLPAEKK
PLRIKIIPPAMPDTRIY
Download sequence
Identical sequences I1H8F7
15368.BRADI1G70950.1 XP_003561930.1.954 EG:BRADI1G70950.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]