SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G71790.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G71790.1
Domain Number 1 Region: 58-95
Classification Level Classification E-value
Superfamily WW domain 0.00000806
Family WW domain 0.004
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G71790.1
Domain Number - Region: 169-197
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.1
Family Di-heme elbow motif 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G71790.1   Gene: BRADI1G71790   Transcript: BRADI1G71790.1
Sequence length 230
Comment pep:novel chromosome:Brachy1.0:1:69724572:69725862:1 gene:BRADI1G71790 transcript:BRADI1G71790.1
Sequence
MVSLQSALLPEAKRPPCLSFVDTSVVASTATSKKRKQRDGEGDIEDEEEECGIELNFDAA
PLPLEWQRCLDIKSGQIHYYNTRTHKRTSKDPRRQSAPAAPAPAALEEDEAANYCGPPGL
DLDLNLAFEPRRRTTQPVVAREKKAAIVAKPAAEAKPSAADEAPGMEMVAAVCMRCHMLV
MMSRACPACPNCKFLHPMMTTSGRGGSSSPTPGPEPAPLKLGLQLLCCRD
Download sequence
Identical sequences I1H8Q9
EG:BRADI1G71790.1 15368.BRADI1G71790.1 XP_003561957.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]