SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G72572.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G72572.1
Domain Number 1 Region: 771-1067
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-69
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 189-530
Classification Level Classification E-value
Superfamily RNI-like 6.83e-63
Family 28-residue LRR 0.026
Further Details:      
 
Domain Number 3 Region: 572-719
Classification Level Classification E-value
Superfamily L domain-like 6.46e-22
Family Polygalacturonase inhibiting protein PGIP 0.005
Further Details:      
 
Domain Number 4 Region: 116-203
Classification Level Classification E-value
Superfamily L domain-like 0.0000000833
Family Ngr ectodomain-like 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G72572.1   Gene: BRADI1G72572   Transcript: BRADI1G72572.1
Sequence length 1092
Comment pep:novel chromosome:Brachy1.0:1:70284230:70288510:-1 gene:BRADI1G72572 transcript:BRADI1G72572.1
Sequence
MTRRRRLSCGRWRTTVSSALCLAVLLLLLSPVAADGDDDDDEQLLERFKAAVPVRNRGQL
EGWTRGDGACRFPGAVCVSVSGVRTRLASLSLAGVPLDVDFRAVAGTLLRLGGVEGISLR
GANVSGSLAPGGGRCGQNLAELDLSGNPALRGSVADAGALAASCRGLRELNLSGNALVSG
GGQRGGTFGNLSVLDLSNNNITGDGDLSWMGGVRRLNLAWNRISGSLFPAFPNCSRMESL
DLFGNLISGELLPGVLSGCTALTSLNLSSNHLSGPFPPEISGLALLSYLDLSNNNFSGEL
PRDAFARLPRLSLLSLSFNSFSGSLPESMDALAELRTLDLSSNLLTGAIPASLCPSTGSK
LQVLYLQNNYLTGGIPPAISNCASLESLDLSLNYINGSIPISIGSLSRLRNLIMWENELE
GEIPASLAGARGLQNLILDYNGLTGSIPPELVNCKDLNWISLGSNQLSGSVPAWLGRLDK
LAILKLSNNSFSGPIPPELGDCKRLVWLDLNDNQLNGSIPPELAKQSGKMPVGITTGRPY
VYLRNDELSSECRGKGILLEISGIRRGDLTRMASKKLCNFTMVYMGSTDYTSSDNGSIIF
LDLSFNKLDSEIPKELGNMYYLMIMNLAHNLLSGAIPAELGGARKLAVLDLSHNQLEGPI
PGPFTSLSLSEVNLSYNRLNGSIPELGSLATFPESQYENNSGLCGFPLAPCGSALVPFLQ
RQDKSRSGNNYYVLKILLPAVAVGFGAIAICLSYLFVRKKGEVTASVDLADPVNHQLVSH
LELVRATDNFSEDNILGSGSFGKVFKGQLSNGSVVAIKVLDMVSKRAIRSFDAECRVLRM
ARHRNLIRIINTCSNMDFRALMLQYMPNGNLETLLHCSQAGERQFGFQERLEVMLGVSMA
MEYLHHDYHQVVLHCDLKPSNVLFDENMIAHVADFGIARLLLQGDDSSMISARLHGTIGY
MSPEYGSDGKASRKSDVFSYGIMLLEVFTGRRPTDAMFIGELSLRKWVHRLFPAELVNVV
DGRLLQGSSSSCCLDGGFLVPILEIGLLCSSDSPNERMRMSDVVVRLKKIKTEYTTWTTS
TFGKAGSCHMSM
Download sequence
Identical sequences I1H903
EG:BRADI1G72572.1 XP_003561989.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]