SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G72750.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G72750.1
Domain Number 1 Region: 168-362
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000000149
Family 28-residue LRR 0.032
Further Details:      
 
Domain Number 2 Region: 648-714,775-830
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 0.0000132
Family ATP-binding domain of peptide synthetases 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G72750.1   Gene: BRADI1G72750   Transcript: BRADI1G72750.1
Sequence length 872
Comment pep:novel chromosome:Brachy1.0:1:70436252:70442727:-1 gene:BRADI1G72750 transcript:BRADI1G72750.1
Sequence
MSPAAAAVPCDDRIRSYDDFARVHAYLLAAAGVPPSLHQRLYRKLADEVFDGGESFAVEP
CEGGRQRRLVLASETPLGRESDVFLVDHAWSFRLSDALKQLREVPGLAERMSALMCVDLD
RRTEIEESDEQDREMSGGLEHVLQVVQKERTRTQEKGSDFAAWLELEELGIDDDMLVSLD
LSANFPNLVALNLWGNKLQDPEKIMQEIRKCGRLKALWLNENPILNQGIDKAVLDGLPEL
EIYNSHFTRKAREWALGFCGNMVGADNPCSSVESISLDNIATLDLSDRCIHKLPEVFCPS
KLSSLSNLNIRGNPLDQVPGDDLLNLFSGFTQLQELEVDIPGPLGNSALPILEALPNLTL
LNGVNALSIAESGKHVVDSALQPRVPEWSPEESLAERVIGAMWLYLMTYRLADEEKVDET
PVWYVMDELGSAIRHSDDANFRIAPFLFMPEGKLASAISYTILWPVGDVHTGDECTRDFL
FGIGEDKQRSARLTAWFHTPENYFIQEFRKYQEQLQSTGICPSTKEKPSTKSLRPSDGRA
LRVFTDIPQVDEFLTRPEFVLTTDPKDADIIWVSMQVDSELKSSLELTDQQYTNQFPFEA
CLVMKHHLADTIHKAWGSPEWLQPTYNLETHLSQLIGDYCVRKQDNMDNLWIMKPWNMAR
TIDTTVTGDLSAIIRLMETGPKICQKYIECPALFQGRKFDIRYIVLVRSICPLEIFLSDV
FWVRLANNQYTLEKTSLFEYETHFTVMNYTGRMNHMNTPEFVKEFEKEHQVKWLDIHESI
CNMIRRVFESASAVHPEMQNTFSRAIYGVDVMLDNRFKPKILEVTYCPDCTRACKYDTSA
VVGNQGAIRGSDFFNTVFGCLFLDDLTNVSPL
Download sequence
Identical sequences I1H926
EG:BRADI1G72750.1 XP_003558676.1.954 15368.BRADI1G72750.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]