SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G74827.2 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G74827.2
Domain Number 1 Region: 58-437
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.31e-99
Family Motor proteins 0.000000886
Further Details:      
 
Domain Number 2 Region: 685-944
Classification Level Classification E-value
Superfamily ARM repeat 2.38e-30
Family Plakophilin 1 helical region 0.026
Further Details:      
 
Domain Number 3 Region: 465-573
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000366
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G74827.2   Gene: BRADI1G74827   Transcript: BRADI1G74827.2
Sequence length 955
Comment pep:novel chromosome:Brachy1.0:1:71897417:71908138:-1 gene:BRADI1G74827 transcript:BRADI1G74827.2
Sequence
MATGAGAAAGRASVRPVDRNGVPRGTARSKSVAPRRPPSPFRARPAAADHDGSADLCRVR
VAVRIRPKNAEELAHGADFDSCVELQPECKKLKLKKNNWTSESYKFDEIFSENASQKRLY
EVVAKPVVESVLEGYNGTVMAYGQTGTGKTYTVGRLGKEDPSERGIMVRSFEHILSSMSL
ETDSVAVSYLQLYLESVQDLLAPEKTNIPIVEDPKTGEVSLPGAAIVEIKDLEHVFQLLQ
IGETNRHAANTKMNTESSRSHAILIIHLQRSLRIKEEMTTSIPNSAEEFFPGDIPLVLKS
KLLIVDLAGSERIDKSGSEGHMIEEAKFINLSLSSLGKCINALAENSPHIPTRDSKLTRM
LRDSFGGTARTSLVVTIGPSARHYSETSSTILFGQRAMRVVNTMRLKEEIDYEILYKKVE
CEVDHLTSEMERQQKLKHIEITQVEKRLKESEMLFNDFRVTSSMQIENLEKEKHQFGYAI
KKLMQELEEKEGQNNVLSQQIIHLETSLNEQKQQQLESLSNTKILADTTKTHEKKMGELL
RQLEEERSHCAGMKDHFNILQQKLSDAQSSAQENMACELKKELSEITTAFTSQLHSLEEK
NSELLSEKELIYEELKSTQEKLQHETTHRQSLESEVLRLKQSWTDNCAEESKTLCGMVRS
GSGLGSAAFMSKSGKSKETQSSQRGTMSKIFEEVGLPSVLALLKSNDLEVQIHAVKVVAN
LAAEDVNQQKIVEEGGLDALLSLLETSENTTIHRATAGAIANLAMNAPSRLNVIAVSNQG
LIMSKGGARLLANVASKTDDPQTMRMVAGAIANLCGNDKWHMMLKRDGGIKALLGMFQTG
HHDVIAQIARGLSNFAKCESRVISQGHRKGRSLLIDDGVLTWIVANSTVLSPSVRRHIEL
AFCHLAQNEENSRDIIVTGGIKELIRISRESSRDDARNLAKKALTSNPAFLKETQ
Download sequence
Identical sequences I1H9L9
EG:BRADI1G74827.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]