SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G75430.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G75430.1
Domain Number 1 Region: 112-496
Classification Level Classification E-value
Superfamily L domain-like 8.16e-69
Family Polygalacturonase inhibiting protein PGIP 0.0036
Further Details:      
 
Domain Number 2 Region: 715-1011
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.73e-66
Family Protein kinases, catalytic subunit 0.0001
Further Details:      
 
Domain Number 3 Region: 462-620
Classification Level Classification E-value
Superfamily L domain-like 2.04e-27
Family Polygalacturonase inhibiting protein PGIP 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G75430.1   Gene: BRADI1G75430   Transcript: BRADI1G75430.1
Sequence length 1046
Comment pep:novel chromosome:Brachy1.0:1:72326714:72330156:1 gene:BRADI1G75430 transcript:BRADI1G75430.1
Sequence
MAGANATPRLSSNARFIFSLSFSLSLLCCVAVSNAAAADEAAALLAIKAALVDPLGALEG
WGGSPHCTWKGVRCDALGAVTGINLGGMNLSGTIPDDVLGLTGLTSISLRSNAFAHELPL
ALVSIPTLQELDVSDNSFTGRFPAGLGACASLAYLNASGNNFVGPLPADIGNATELDTLD
FRGGFFSGAIPKSYGMLQKLKFLGLSGNNLNGVLPTELFELSALEQMIIGYNEFHGPIPA
AIGKLKKLQYLDMAIGSLEGPIPPELGQLPDLDTVFLYKNMIGGKIPKEFGNLSSLVMLD
LSDNALTGSIPPELSKLSNLELLNLMCNRLKGGVPAGLGELPKLEVLELWNNSLTGPLPP
SLGSKQPLQWLDVSTNALSGPVPVGLCDSGNLTKLILFNNVFTGAIPAGLTSCESLVRVR
AHNNRLNGTVPAGLGKLPRLQRLELAGNELSGEIPDDLALSTSLSFIDLSHNRLRSALPS
GVLSIPTLQTFAAADNDLVGAMPGELGECRSLSALDLSSNRLSGAIPQGLASCQRLVSLS
LRGNGFTGQIPTAIAMMPTLSVLDLSNNFLSGQIPSNFGSSPALEMLSVANNNLTGPVPA
TGLLRTINPDDLAGNPGLCGAVLPPCGPNALRASSSESSGLRRSHVKHIAAGWAIGISIA
LVACGAVFVGKLVYQRWYLTGCCEDGAEEDGTAGSWPWRLTAFQRLSFTSAEVVACIKED
NIIGMGGSGVVYRADMPRHHATVAVKKLWRAAGCPEEANTTATATASAAAAKNNGGEFAA
EVKLLGRLRHRNVLRMLGYVSNDADTMVLYEYMSGGSLWEALHGRGKGKHLLDWVSRYNV
ASGVAAGLAYLHHDCRPPVIHRDVKSSNVLLDANMEEAKIADFGLARVMARPNETVSVVA
GSYGYIAPEYGYTLKVDQKSDIYSFGVVLMELLTGRRPIEAEYGETGVDIVGWIRERLRS
NTGVEELLDAGVGGRVDHVREEMLLVLRVAVLCTARLPKDRPTMRDVVTMLGEAKPRRKS
SSATVAATVVDKDKPVFTTSPDSGYL
Download sequence
Identical sequences I1H9U1
XP_003562099.1.954 EG:BRADI1G75430.1 15368.BRADI1G75430.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]