SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G75950.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G75950.1
Domain Number 1 Region: 538-837
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.29e-75
Family Protein kinases, catalytic subunit 0.00028
Further Details:      
 
Domain Number 2 Region: 95-199,231-251
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.19e-23
Family alpha-D-mannose-specific plant lectins 0.0049
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G75950.1
Domain Number - Region: 407-455
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0049
Family Pan module (APPLE domain) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G75950.1   Gene: BRADI1G75950   Transcript: BRADI1G75950.1
Sequence length 852
Comment pep:novel chromosome:Brachy1.0:1:72691968:72694806:-1 gene:BRADI1G75950 transcript:BRADI1G75950.1
Sequence
MHIYILLSPINPSILLFSMAPIYTLALLGALLLLLQTPPCSSATTANGDTLTAGQALTVG
DNLVSKNGKFALGFFQFQAASSNVSKSKNTTTSPNWYLGIWFNKIPVFTTVWVANREKPI
TDPKSNSTHLTISRDGNLVILHHAVVIWSTKIVVTNRTARTNRTNTTSVVLMNSANLALT
ESPSSSDAPLWQSFDYPTDVVLPGAKFGWNKLTGLNRRGISKKSLIDPGLGSYSVELETS
GNGIILKRRKPSVMYRNYAPESSSILKLMPRIIKLLQLDPLSKALILPQYHNDTEEEYYM
YTSPDESSSTFLSLDVSGQIKLNIWSQDKQSWQPILADPIDVCTPAATCGPFTVCNGNAQ
PPCDCMGSFSKKSPWDWQLEDRTEGCIRNTPLNCTNNKNTTSSTDTFHPIARVTLPYDPQ
SIDAAATQSKCEEACLGSCSCTAYSYNNSICSVWHGKLLGVSLNDGVEINSEDILYLRLA
AKDLPTSLQKDKRKPNVGVVTAASITSFGLLMLMLLLVIWRNKLWCCGSPLHGNQGTSGI
IAFRYTDLAHATKNFSEKLGGGGFGSVYKGVLSDSTTVIAVKRLDGTRQGEKQFRAEVSS
IGLIQHINLVKLIGFCCEGGNRLLVYEHMKNGSLDAHIFKSNADVLNWNIRYQIVIGVAR
GLSYLHQSCRECIIHCDIKPENILLDASFFPKVGDFGMAAFVGRNFSRVLTTFRGTIGYL
APEWLSGVAVTPKVDVYSFGMVMLEIISGRRNSPEAYSGSGDHVEYFPVRAISILHGGNV
QGLVDPQLHGQFDLEQAELVAKVALWCIQDNEFNRPTMSEVVLVLEGLQEIDMPPMPRLL
AAITERPGSALM
Download sequence
Identical sequences I1H9Z9
EG:BRADI1G75950.1 15368.BRADI1G75950.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]