SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G76677.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G76677.1
Domain Number 1 Region: 44-165
Classification Level Classification E-value
Superfamily SMAD/FHA domain 9.56e-17
Family FHA domain 0.0018
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G76677.1
Domain Number - Region: 216-338
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00259
Family Myosin rod fragments 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G76677.1   Gene: BRADI1G76677   Transcript: BRADI1G76677.1
Sequence length 862
Comment pep:novel chromosome:Brachy1.0:1:73167675:73173976:1 gene:BRADI1G76677 transcript:BRADI1G76677.1
Sequence
MAAAEPPNEALETPKLASKGEVASKTTPVSADEMRAVARKFADQPLQNPEPGVWAVLTAI
SKNARLRPEGMNILLNADEHILGRMVDNPRFRISSLSVSGTHCKIYRDTVLAELNRNEPA
PVFLKDTSTNGTYINWKKFTKKSSPTKLNHGDIISFTTAPHNDASYAFVYREVNAVSCVE
NGATILKRKSGEVGSESKRLKGLGIGSAEGPVSLDDVRRLEKSNAELREQLEKHVVTIET
LRTASKLAQEQHEKELMEVKETTSSNYLGQTESLHLALKEKQTQLDSLSTLTTDLQNSIK
DLDERLTASKQSRTDADEIIHSQKANICELEEQLSEERNLRIEERDKAAEDLKSALHKVQ
SEAQEEIKRQTEIYLKQQREQKEFITKLQESEKETRLRVETLRSKLEDSRESLVTSEKRV
RALEAQLQDEQLVSTNNRKKSDNLEAELRKLKKELENEKAAREEAWAKVSSLELEIDATI
RDLSIEKRRYQGARERIILRETQLRAFYSTTEEISSLFAKQQEQLKAMQRTLQDEENYES
TLMGIDVDLNEVPRANAITDDAHVKPVDYAKDTMEASGASTQNTQASEHSCSDEDANMTE
QQDGGTRVEGGTQDLECTSPERSVEQFRPDSHGDVTPRAPEQEPTDTEKFPETESQAGNV
GCNDHSSTHGDMGGETMQLEDEVQPQENEDSALICKGGGQTPETEEPTTALTLKDGIGQC
SEEKREGNGSENKPEDTQTGTIVTADLLTSEVPGSWAVETGPSVNGENDSPWSLGDPRGG
QDDNVGERAAADALTSLVNSDGQAAGSQTNVDNVITKISDDCRVLGHMIGLLDPEKKLGG
DDSMSDAETDDSSEAMVEDSVG
Download sequence
Identical sequences I1HA85
XP_003562152.1.954 EG:BRADI1G76677.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]