SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G77650.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G77650.1
Domain Number 1 Region: 146-266
Classification Level Classification E-value
Superfamily TPR-like 4.17e-16
Family Tetratricopeptide repeat (TPR) 0.0031
Further Details:      
 
Domain Number 2 Region: 225-353
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000352
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Domain Number 3 Region: 362-475
Classification Level Classification E-value
Superfamily PH domain-like 0.0000822
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G77650.1   Gene: BRADI1G77650   Transcript: BRADI1G77650.1
Sequence length 491
Comment pep:novel chromosome:Brachy1.0:1:73890849:73897796:1 gene:BRADI1G77650 transcript:BRADI1G77650.1
Sequence
MPEMEESAQPKPADPSEPEHPNGAGEPVLEPEPVSPDAEAPSAAEEVAVVEEEAPTRSAS
AKDAETNAEGWRPYTMGELLGEAAEAAAAGRSAFAEENGVGSAAADGSSQDNLRLSSNND
VAMDLINSVTGVDEEGRSRQRILTFAAKRYISAIERNPEDPDAYYNWALVLQESADNVDP
DSDSSKDSLLEEACKKYGEATRLCPTLYDAYYNWAIAIADRAKMRGRTKEAEELWHQAIM
NYDKAVQLSWNSPQALNNWGLGLQELSAIVPARDKQSIIKTAINKFRSAIRLQFDFHRAI
YNLGTVLYGLAEDTSRSGGPDASPSDLYSQSAIYVAAAHALKPNYSVYRSALRLVRSMLP
LPYLKVGYLTAPPADDPIAPHKHWERSQFILNHEELQQANASESSPRKSLGHVEKSKRFI
KVNVVDIVSVSTCSDLTLPPGAGLCINTTHGPVYLVADTWESLDGWLDAIRLVYTIFARG
KSDVLAGIITG
Download sequence
Identical sequences I1HAK7
XP_003558984.1.954 15368.BRADI1G77650.1 EG:BRADI1G77650.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]