SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G77667.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G77667.1
Domain Number 1 Region: 186-543
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.23e-122
Family Motor proteins 0.000000311
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G77667.1
Domain Number - Region: 544-641
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000418
Family Myosin rod fragments 0.0049
Further Details:      
 
Domain Number - Region: 99-186
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0392
Family Myosin rod fragments 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G77667.1   Gene: BRADI1G77667   Transcript: BRADI1G77667.1
Sequence length 859
Comment pep:novel chromosome:Brachy1.0:1:73904566:73909118:1 gene:BRADI1G77667 transcript:BRADI1G77667.1
Sequence
MAAKSGTNGSILCKRCATDVEISPIQKRTAKLMKKYEKQIEELTSQCNMKSDECSMAWSL
VESTNQELERLKIELHQKLVQSDNFEQVLGTQTDQLRNVSHNYENDKKLWAAAISNLESK
IKAMKQEHALLSLEAHDCANSIPDLSKMIGAVQGLVAQCEDLKMKYNEEMAKRKKLHNIV
QETKGNIRVFCRCRPLSKAETSSGYKCVVDFDGANDGDIGIINGGPSKKTFKFDRVYTPK
DDQAEVYTDASPLVTSVLDGYNVCIFAYGQTGTGKTFTMEGTERNRGVNYRTLEELFRIA
EERKESVTYSISVSVLEVYNEQIRDLLATSPSSKKLEIKQAGEGSHHVPGIVEAKVESID
EVWDVLQTGSNARAVGSNNVNEHSSRSHCLLCIMVRAKNLVNGDCTRSKLWLVDLAGSER
LGKTDAQGDRLKEAQNINKSLSALGDVISALASRSSHIPYRNSKLTHLLQDSLGGDSKAL
MFVQISPSDNDVSETLSSLNFASRVRGIELGPAKKQVDTVELQKVKQMLERSKQEVRLKD
DSLRKLEENCQNLEHKAKGKEHLYKNLQEKVKELESQLDSKTHSQITSEKQHYQLSGKLK
DKEEMCTALQQKIVELERKLRQQHQSDSEVAILKQTIEELELKLKEQEQQRAVAESKARE
IGQELLEAQKTESMLQNKLLDVEKNLQERTTLQLTNTTLDSSNSAIMVATTPGTTTAQPI
VREEAMSEKDHHRILRSSDSANKRVASNPSLPPAPPEVVNEKKRKGEARNTVSIGGDEQE
NNNPAAVSQNAARKRSLQGEPRSKRTSTEPQTKALMRPTAAAASRAASAAAAQKTVPGSR
ASRPQQPATGGNKTRGWVR
Download sequence
Identical sequences I1HAL0
EG:BRADI1G77667.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]