SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G78320.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G78320.1
Domain Number 1 Region: 346-718
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 2.35e-114
Family Oxysterol-binding protein 0.00093
Further Details:      
 
Domain Number 2 Region: 46-80,108-164
Classification Level Classification E-value
Superfamily PH domain-like 2.52e-16
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G78320.1   Gene: BRADI1G78320   Transcript: BRADI1G78320.1
Sequence length 728
Comment pep:novel chromosome:Brachy1.0:1:74349506:74354898:1 gene:BRADI1G78320 transcript:BRADI1G78320.1
Sequence
MRARDLHPLCCLPVDYCPGGWCAAPAAGDRSPPPALNQQQPAPAPAVVAGVLHKWTNIGK
GWRPRWFAILPGGSVLAYYKIRRRRSRAASSPPAPGDAGPRLIGPPGYAAEDRPIGLVHL
KISSFRESRSDDKRFYVITPTKTLQLRTNSAKDRVAWIEALVSARSESSPIGGLLYDQND
VSFSTDRLRNRMHAEGLGEEVIRDCEQIVHSEFSQYSIQMKQRCEEYLSFLGSLPQQLEV
LNAEDTTHSIKPECSCSGLGKFSESSNTESSDDAGAQELDELSDEDEYNFCDTRQSFSDS
AASPVLRMKCSNSSNNHKSVESRSSNGNNVLVPSKRRTKLPEPVEKEKGVSLWSMIKDNV
GKDLTRVCLPVYFNEPISSLQKCFEDLEYSHLLDRAHDFGLKGNSLMRTLCVAAFAASGY
ASSDGRPCKPFNPLLGETYEADYPEKGLRFFSEKVSHHPMVMACHCEGRGWKFWGESNVK
SKFWGQTIQLDPVGVLTLQFDDGETFKWSKVTTTINNIIIGRLYCHHHGTMTITGNKQYS
CKLTFKQQSFLERNPRQVQGFVEDMSGTRVAALTGKWDESMYYTVTQDIPGVNSSAGATL
LWEKNEPPSNPTRYNLSSFAITLNELTPNLKEKLPPTDSRLRPDQRHLENGEYDKANSEK
LRLETRQRMARKMQDNGWKPRWFDRDAEDGTFRYTGGYWDAREEGTWDGCRDIFGELSSN
RTCTSVDI
Download sequence
Identical sequences I1HAU3
15368.BRADI1G78320.1 XP_003559029.1.954 EG:BRADI1G78320.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]