SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G78487.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G78487.1
Domain Number 1 Region: 278-383
Classification Level Classification E-value
Superfamily PH domain-like 0.00000357
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G78487.1   Gene: BRADI1G78487   Transcript: BRADI1G78487.1
Sequence length 403
Comment pep:novel chromosome:Brachy1.0:1:74462684:74464727:-1 gene:BRADI1G78487 transcript:BRADI1G78487.1
Sequence
MERFCQGRVDTAAGLLATHHMEEEEGLVSMVIPPLQTPMEPMEYLSRSWSVSAEEISKAL
LLSGSNKRTFFAATDRLMPQLPQMAAITETETPALVVVPVSASSHHQFQQQHLDATRNSI
SCHHQHANSVSRWFRRKETTRRAKCGRKEKARADKAHVHAMVSVARVSAAVAAVTAATSF
DNQNSKIAAAMASATELLASHCAEVAQIAGAGHEQVSSAVRSVVDVASPGDLITLTAAAA
TALRGAATLNKRVQLETRSNASVLPCEKAPSWSPDIWCKEGKLLKRTRKGNLHKRWVSIY
INKRSQVILKLKSKHIGGALSKNNKSVVYGVYSDLPEWTEPGQSSPETCCFGLSTAQGLV
EFKCQSSTNKQNWVHGVQNLLQQVDVADQVGHRLETLKLNWRG
Download sequence
Identical sequences I1HAW1
XP_003562239.2.954 EG:BRADI1G78487.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]