SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI1G78820.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI1G78820.1
Domain Number 1 Region: 86-143,179-213
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000000104
Family Protein kinases, catalytic subunit 0.005
Further Details:      
 
Weak hits

Sequence:  EG:BRADI1G78820.1
Domain Number - Region: 22-83
Classification Level Classification E-value
Superfamily L domain-like 0.00952
Family Polygalacturonase inhibiting protein PGIP 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI1G78820.1   Gene: BRADI1G78820   Transcript: BRADI1G78820.1
Sequence length 225
Comment pep:novel chromosome:Brachy1.0:1:74800326:74805240:-1 gene:BRADI1G78820 transcript:BRADI1G78820.1
Sequence
ALLFFFLPATMLAAPSLQRNNDTDLATLLAFKARLSDPLGILGGNWTSGTSFRNWVGVSC
SRRRQRVTALMLPGIPLQGPVSPYLELAYMGKVSRKSDVFSFGIMLLEVFTGKRPSNAMF
VGESNLGHWVSEAFPVRLTDIVDEKLLLGEEISTRGFHDQTNITSSASPSTACNSNFFVP
TFELGLECSSESPDQRASMSEIVVRLKNIIKDYSASVMAAQRAEG
Download sequence
Identical sequences I1HB05
15368.BRADI1G78820.1 EG:BRADI1G78820.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]