SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G00490.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G00490.1
Domain Number 1 Region: 213-480
Classification Level Classification E-value
Superfamily L domain-like 4.65e-53
Family Polygalacturonase inhibiting protein PGIP 0.015
Further Details:      
 
Domain Number 2 Region: 45-240
Classification Level Classification E-value
Superfamily L domain-like 1.29e-39
Family Polygalacturonase inhibiting protein PGIP 0.012
Further Details:      
 
Domain Number 3 Region: 515-588
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000223
Family Protein kinases, catalytic subunit 0.012
Further Details:      
 
Domain Number 4 Region: 553-656
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000000307
Family Protein kinases, catalytic subunit 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G00490.1   Gene: BRADI2G00490   Transcript: BRADI2G00490.1
Sequence length 673
Comment pep:novel chromosome:Brachy1.0:2:217891:220867:1 gene:BRADI2G00490 transcript:BRADI2G00490.1
Sequence
MGLVSLLSSLAAILMMVVVSAGDEAALLAFKAQASGGAGGSRALASWNDSAHFCSWEGVT
CSHRRTKQVVVALSLHRGELTGALSPVLGNLTFLRTLNLSYNSLHGEIPASLGRLRLLKN
LDLSHNQLVGSIPPELGSIQSMQILQLSANKLSGTIPSSLSNLSDLTVLVLELNRFSGYV
PPTLGRLGALQDLYLTVRLEANEKEGWEFITSLANCSQLRRLILSSNPFGGQLPRSIVNL
STSLQMLRLDDNRISGSIPADIGNLVGLNILLIVNTSMSGVIPESIGKLKNLVDLGLYST
GLTGIIPQSVGNLTELTRFLAFWNNLEGSIPASLGNLKNLFILDLSTNYRLNGSIPVEIF
QLPSLSWYLDLSYNALCGPLPSEAGTMTNLNELILSGNQLSGQIPSTIGNCIVLQKILLD
KNSFEGSIPKSLENIKGLNILNLTMNNLSGRIPDAIGGIRDLQQLYLAHNNLSVILGVCV
LHKKLKRNQQTVIEYSIAGDHYERIPYDALFRGTDGFSEVNLIGRGSYGAVYKCVWTLTK
EPWLSRCLTLVNPEYGEGYAVSTRGDIYSLGILLLEMFTGRSPTNDTFRDSLDLHKFAED
ALPDRTLEIADPTIWLHSEPLDSTTSTRIQECLVSVFRLGISCSKQQPRERTLIRDAAVE
MHAIRSAYLLLGG
Download sequence
Identical sequences I1HB41
15368.BRADI2G00490.1 EG:BRADI2G00490.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]