SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G03437.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI2G03437.1
Domain Number - Region: 42-186
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.000122
Family CAT-like 0.081
Further Details:      
 
Domain Number - Region: 273-394
Classification Level Classification E-value
Superfamily CoA-dependent acyltransferases 0.0267
Family NRPS condensation domain (amide synthase) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G03437.1   Gene: BRADI2G03437   Transcript: BRADI2G03437.1
Sequence length 488
Comment pep:novel chromosome:Brachy1.0:2:2510696:2513247:1 gene:BRADI2G03437 transcript:BRADI2G03437.1
Sequence
MAMDSELEIPGDCEYLGPPDLIPPNGPTPRHTLYLSNLDDQRFLRFSIKYLYVFPASGAI
PIPTLKAALAAALVEYYPLAGRLKPSEEEEGKLVVECNAEGALFAEAALPGIAAADFRGA
RPPHKSWRKLLYRVDSNGFVDVPPLVVQVTHLGCGGMVLCTAINHCLCDGIGTAHFLHAW
ARAAAARGISPVSGIAIVHDRRALRPRRPPLIAFTHPEYSNGNADAAGIAHLLGGQPLSP
VSLTFTASHLAHLKNQLLTSPSSPSSPAPALKRCTSFEALAAAVWRAWVRALDPSPSPSS
LPVKLLFSVNVRNRLTPELPAGFYGNGFVLGCAESTAAQLTASDSMAATVRLVQGAKDSV
DDAYVRSMVDLLEADRGRKPDLAASLVISAWTRLGLEELDFGNGAPLHMGPLTSEIYCVF
VPVAGDPRGVSVLVSVPLAAADRFRHYCCHPCGVEDGGGAMADMLEKGEKPQQQQQQACL
GQGIKMDC
Download sequence
Identical sequences I1HC35
EG:BRADI2G03437.1 XP_003565349.2.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]