SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G03947.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G03947.1
Domain Number 1 Region: 632-915
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.74e-75
Family Tandem AAA-ATPase domain 0.000046
Further Details:      
 
Domain Number 2 Region: 17-52
Classification Level Classification E-value
Superfamily WW domain 0.000000191
Family WW domain 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G03947.1   Gene: BRADI2G03947   Transcript: BRADI2G03947.1
Sequence length 1332
Comment pep:novel chromosome:Brachy1.0:2:2780356:2787789:1 gene:BRADI2G03947 transcript:BRADI2G03947.1
Sequence
MASAEAAADSSGPRFAPDDPTLPAPWKALIDGATLYYWNPETNVTQYDKPAAAAAAAAPP
LPAAAPAPVPGAFAQPGMQLGGQAGQQQQPQQTAQQPPFQYQAQQQQPQQTAQQPPFQYQ
APQAQQHGPYMQPQQQGQQYSYQAGQHPQMPQTPYNQGQQPPIPTSCKSRSAANDATRCL
HSRSASTNAAICLQSWSAAAYATGCLQSRPAATDAASCLQSRPAATNAASCYDQGQQLQG
ARIPQSQVQHTKQSPGFHQPAQASQVLPTSQPQGLQMSPRQGQPQHGFQFTHQQGKQPHQ
GHIGAHVSQLSHGQQSSAVKLDAGGHEGMQSGFALPISLQRGQAPPLSNQQLPSNHQRPE
AHNQLSIHGVHGVGGPAYPAKHHLGGSSPGETNKMSFMSLPAQAHQGGVETNYRQQLPSS
HAVPNHITPSPGQPPIGFNRSSSEDQFEKNEPHSSGRFDGINALQQQPKLAALPPSQIRL
QDMRNGAPYPQPDNFGGYNMAPPNPVQNPHNHVPFPIGALTRPPPGTFSPPDFPSVASVD
AYREHHEVTAVGENVPPPFMTFEATGFPPEILREVHAAGFLNPTPIQAQTWPVALQNRDI
VAIAKTGSGKTLGYLIPAFVHLRRCQNNPMLGPTVLVLAPTRELASQIQDEALKFGRSSR
VSCTCLYGGAPKPPQLRELERGADIVVATPGRLNDILEMKKISLHQISLLVLDEADRMLD
MGFEPQIRKIVDEIPRNRQTLMYTATWPKEVTKIAGDLLRDPVQINIGSIDELVANKSIT
QYVEMVPPMDKQRRLEEILRAQERGSKIIIFCSTKKMCDQLARGIGRSFGAASIHGDKSQ
GERDHILNQFRTGRVPVLVATDVAARGLDIKDIRVVINYDFPTGIEDYVHRIGRTGRAGA
TGIAFTFFSEQDWKYAGDLVKVLDGTSQPVPPELQQMAARGAPGAPRHQAGGMSRWDGPG
GSSRFESAVNGPGGYGGFREGPGGFGGRDGPGGFVDRDGPGMFGDRDGPGRFGGRDGPGG
FGGRDGPGGFGGRMGPGGFGGREGPVGFGGREGPGPSGFSGRGGRGSDGFGRRGGASPGR
FGGHGGRSDSPGFGGRGRGDSSGFGGRGRGDFSGGRGGRGRGFGGRGRSDRSPHDRFISD
GRGRYDDRRGFGDKGRGRSYSRSPDRGRSRGYDRRSDSRSLSSRSRSRSRSWSRSRSRSR
SWSRSRSRSRSRSRSRDQGAGLERRPRARSGFDVLPPATEAGPVLTGPVPVSEPVPAVAA
LRPGQALVETLDMSPMSPGGLVQEGGPFIGGNDANISSARADQASHGTDLAIPPSFSAPE
NFPGLTGQQDAP
Download sequence
Identical sequences I1HCA2
EG:BRADI2G03947.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]