SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G03990.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G03990.1
Domain Number 1 Region: 828-965
Classification Level Classification E-value
Superfamily BRCA2 helical domain 4.32e-39
Family BRCA2 helical domain 0.00046
Further Details:      
 
Domain Number 2 Region: 966-1110
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.06e-33
Family Single strand DNA-binding domain, SSB 0.00026
Further Details:      
 
Domain Number 3 Region: 1141-1254
Classification Level Classification E-value
Superfamily BRCA2 tower domain 2.22e-29
Family BRCA2 tower domain 0.0027
Further Details:      
 
Domain Number 4 Region: 1111-1140,1254-1338
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.57e-21
Family Single strand DNA-binding domain, SSB 0.0068
Further Details:      
 
Domain Number 5 Region: 1340-1499
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 8e-19
Family Single strand DNA-binding domain, SSB 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G03990.1   Gene: BRADI2G03990   Transcript: BRADI2G03990.1
Sequence length 1501
Comment pep:novel chromosome:Brachy1.0:2:2804463:2815407:-1 gene:BRADI2G03990 transcript:BRADI2G03990.1
Sequence
MQRRWQVFAQPDGSLAWIPVAPPAPPPLPGRAAGSALPTVPAAAVAPAPAASGDDGALVE
ETLGAGGAEGARAASMKDILVQARNKMVEGDGMSEAIVDGGKDELFCTGSGRSVSVSERT
IRRARALVGDEAGETSNKRIKQPIGDGADLEGELGGMDVSFRGEGHNSSMSPVFQTGSGK
AVSLSKDSVQKARVILEDVGGVDSMEQFPLFQTGSGRAVSVSVASFQKAKSVLGENNTSG
GRPVMISEGPTESCRAAVLEEDAEKSGLGRPVAVSRSSVQKARAVLEEQNIKETGHGDTS
DCPTILQTETPRSVLMSSSLITNDRSVTPKGDSTMQGRSVAISKSSIKRASAVLEPRNIA
KELEDEAHLHGGHDGALVFKTGLGRTILASENSIKKVQVILEAQEEAKSVNNDNGEAYAE
DATFQAGAQKFVPQNGSSSHNASILFEQGSFAEKGYEDYGSQLPMFQTGSGKSVLISESS
VQKARAVLEEECNMNRDNHKLLNSKDKKFHVFTSPLKTTCARTVNISSVGVSRAAALLGL
EENTLSTQFFGHVGEKLGTKITVERENPEQRLGTASVHGISGGCSMSSFPTENQVLKEPH
MSFLLSNSTLSDSGECPIRFSTAGGRSMAISSDALQRAKSLLGESELAVSKDDLVGHSSV
SVSKDEIPSSTLAWKEGDLDLPKISRAEGKTELSTFSHEAIPEKKHTGSFGYAVPDTLAT
KGNGNRFHVGSHSISNIPKIPKPSSRCLSESDNASDTKDMARRLHMPSGALVDITNFMGE
HSGNINHVNNEKRRSVGRNSASPFKRPRSSRFIAPINTNKQSSTGVHKLPPTLITPCRTK
LSACYPFQHKRKTWKEYFGGRPCFNLSKEHLTDEVKLMDAKRAEKYTFDSLGTGAEEFQK
MLLACGASSTYATKEWVSNHYKWIVWKLASLERCYPTKAAGKFLTVANVFEELKYRYDRE
VNNGHRSAIKKILEGNALPSLMMVLCISAIHSRPGISKCKLEAGRADTNEDISGNKSLTA
AHRNKSAQIELTDGWYALEASLDVALSEQLDKRKLSIGQKLRIWGASLCGWTGPVSFHEA
SGTVKLMVHVNGSYRARWDDTLGFCKHVGPPLAFKCIKASGGRVPRTLVGVSRIYPVLYK
EKLPDGRSVVRSERMERKAVQMYHQRVSKITEDILCEQEENCGSTDDSEEGAKICKMLER
AAEPEVMMAGMTSEQMMSFSSYQEKQKVVRQNKVAKKVEKALEVAGLGPRDITPFLKLRV
TSLVHKTTATKTTKEGLITIWNPTEKQKADLVEGQIYFVTGLVPCTYCTDILYLHARGPS
TMWKQLASVQAKDFEPFFTPRKVVELSSFGDVPLASEFDIAGVVLHVGDVYLCSSQKRQW
LFLTDGSKFISGQQSTEQNDCLLAVSFSCPIAGDDYAFFSYALSGNTVGFSNLVKRQKDQ
MRRLWVAEATESTTYTISHEISKRSHLKEAATCAEKWASSSYPKIQELKERVLCIIGDSG
G
Download sequence
Identical sequences I1HCA6
EG:BRADI2G03990.1 15368.BRADI2G03990.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]