SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G04070.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G04070.1
Domain Number 1 Region: 155-170,226-334
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 2.22e-33
Family Staphylococcal nuclease 0.0012
Further Details:      
 
Weak hits

Sequence:  EG:BRADI2G04070.1
Domain Number - Region: 175-215
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00235
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G04070.1   Gene: BRADI2G04070   Transcript: BRADI2G04070.1
Sequence length 345
Comment pep:novel chromosome:Brachy1.0:2:2864403:2867235:1 gene:BRADI2G04070 transcript:BRADI2G04070.1
Sequence
MGNSIYRFLCGVCSDLCSAASESAYQPHGAHAAVAALGRDILHFQRTKQVPEGLSRHVVS
SQNAQANWYKKLQVAWKKARPAPTTPEDAARLVVLTLKNHQKADVEGLLAFYGLPHPNAA
SAAPPPPSSAAPAPAHHAGPAHKPPGVKFELHTLPVDAKAVADGDTITVYVDTSGEPGSV
PGDIKKAAAERTKLRAARNYPKADALQKTMADAGYRQVPNAKGQEVLAKKYRIRLSGIDA
PESAMPYGKEAKEALLKMVEGKPLTVHVYDTDRYGRSVGDIHCNGVFVQEQMLKKGFAWH
YTAYDKRPELAKWQKQAQDGRKGLWASSRPQEPWEYRKAKRNGTA
Download sequence
Identical sequences I1HCB5
EG:BRADI2G04070.1 XP_003569116.1.954 15368.BRADI2G04070.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]