SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G04080.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G04080.1
Domain Number 1 Region: 60-71,129-213
Classification Level Classification E-value
Superfamily Staphylococcal nuclease 3.01e-21
Family Staphylococcal nuclease 0.0037
Further Details:      
 
Domain Number 2 Region: 77-118
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000196
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G04080.1   Gene: BRADI2G04080   Transcript: BRADI2G04080.1
Sequence length 435
Comment pep:novel chromosome:Brachy1.0:2:2867649:2871652:1 gene:BRADI2G04080 transcript:BRADI2G04080.1
Sequence
MYAAQSHRCRRARERGIHAHGGVARKRTSLSPPQVLLCFIGAAVLLANARHALFAKVDAK
AVADGDTMTVHVDTADPREFGNVPPEVQEAVAERTKARAAKDYQKADALQKILVDAGYRQ
VPNSRGEQVLAKKYWIRLRGIDAPENSMPYGKEAKEELVKLVQGKALKISIYDKDRYDRL
VGDVECNGIFVQEHMLKRGLTWHYTAYDRRLELATISRVFDLRLAADDPWCYCRAIHDSV
LMPAWIVFWRADTMKKHQAQGISAGGVYRYTHRREGGADIHDVFVEKSASRLLFSYIGAM
LLLANVCYALLKQESLCLSSFWCVPFSAIVAKSLQYKPVKKESLMIMPGFGVQLEQHFWS
GRVHRQFVPIGKILKPVLNECVTPVTCYWSLALLVRNEDKITLVFKKLHPPVKMLVPIWK
ALCAFTSSDSITSPS
Download sequence
Identical sequences I1HCB6
EG:BRADI2G04080.1 15368.BRADI2G04080.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]