SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G04460.4 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G04460.4
Domain Number 1 Region: 245-529
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.32e-76
Family Tandem AAA-ATPase domain 0.0000731
Further Details:      
 
Domain Number 2 Region: 8-49
Classification Level Classification E-value
Superfamily WW domain 0.00000289
Family WW domain 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G04460.4   Gene: BRADI2G04460   Transcript: BRADI2G04460.4
Sequence length 673
Comment pep:novel chromosome:Brachy1.0:2:3137607:3142533:-1 gene:BRADI2G04460 transcript:BRADI2G04460.4
Sequence
MASSAGPRYAPPDPTLPKPWRGLIDGTTGYLYFWNPETKAVQYDRPTGPPPPAPAPLPAP
VAQPAYPEERARNRDAPEPQAQAAASRLQSAPADHLERRSEAAGNRVQNVPFADHKPRSD
PSLEPRYSGGVHHTAVTSTNQVSQAANGNHISPEAYRAKHEITIIGNESPAPFMTFQSTC
FPPEILREVQQAGFSAPSPIQAQSWPITLKGRDIVAVAKTGSGKTLGYLLPGFILVKNLR
NNSRDGPTVLVLSPTRELATQIQDEAVKFGRSSRISSTCLYGGAPKGPQLRDLERGADIV
VATPGRLNDILEMRKVSLHQVAYLVLDEADRMLDMGFEPQIRKIVKQVQPKRQTLMFTAT
WPKEVRKIASDLLTNPVQVNIGNTDQLVANKSITQYVEVISPMEKQRRLDQILRSQEPGS
RIIIFCSTKRMCDQLSRNLSRQYGASAIHGDKSQAERDSVLSEFRNGRCPILVATDVAAR
GLDVKDIRVVVNYDFPTGVEDYVHRIGRTGRAGATGLAYTFFCDQDSKYASDLVKILEGA
NQSVSQQLRDMASRGGYGSRPPRRWASSNDSYGGQGSFGSHSRDGSSFQSSAYNSSSGNT
FGSTPSFHSSSNNNQSSGNPSFPASGGNNQSGDGLSFHERFYSSRGADQNRTSNDGFRAR
SRSPPKAVGVSNW
Download sequence
Identical sequences I1HCG2
EG:BRADI2G04460.4 XP_010230516.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]