SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G04950.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G04950.1
Domain Number 1 Region: 64-309
Classification Level Classification E-value
Superfamily Pseudouridine synthase 5.28e-77
Family Pseudouridine synthase II TruB 0.00000214
Further Details:      
 
Domain Number 2 Region: 311-392
Classification Level Classification E-value
Superfamily PUA domain-like 6.63e-23
Family PUA domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G04950.1   Gene: BRADI2G04950   Transcript: BRADI2G04950.1
Sequence length 591
Comment pep:novel chromosome:Brachy1.0:2:3540623:3542739:-1 gene:BRADI2G04950 transcript:BRADI2G04950.1
Sequence
MSSQPPAVASPGSELTKSKKKKSKSKDASADPAAGDDNPSLAEAEAKTDGYMIKPQSLVP
SLDTSTWPLLLKNYDRLNVRTGHYTPLPSGHSPLKRPLQEYLRYGVINLDKPSNPSSHEV
VAWIKRLLRVEKTGHSGTLDPKVTGNLIVCVDRATRLVKSQQGAGKEYVCIARFHAAVPD
TARVARALESLTGAVFQRPPLISAVKRQLRVRTIYESKLLEHDAERHLAVFWISCEAGTY
VRTLCVHLGLLLGVGAHMQELRRVRSGILGEQDNMVTMHDVMDSMWALDNHKDESYIRRV
VMPLEVILTSYKRLVVKDSAVNAICYGAKLMIPGLLRFENDIDVGEEVVLMTTKGEAIAI
GIAEMPTAVMATCDHGAVAKIKRVVMDRDTYPRKWGLGPVALKKKKMIAEGLLDKHGKPT
EKTPAEWLRNVVLPTGGDAMIASIAAAPEPEKVKVEQADVKEKNKHEEDKADGGRKRKVD
EDDASASTPAKKIKSEEVIEAVEGEKSEKKKKKKKDKGEPGSAVSEAVEEKGDLTDQEKG
GSEKKKKKKKNKEETDLVKPESAPDGAVEEGEKSDKKKEKKKKKNRDVEEA
Download sequence
Identical sequences I1HCM0
XP_003569731.1.954 15368.BRADI2G04950.1 EG:BRADI2G04950.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]