SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G05130.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  EG:BRADI2G05130.1
Domain Number - Region: 223-295
Classification Level Classification E-value
Superfamily Tropomyosin 0.00654
Family Tropomyosin 0.0072
Further Details:      
 
Domain Number - Region: 595-696
Classification Level Classification E-value
Superfamily Tropomyosin 0.0157
Family Tropomyosin 0.0097
Further Details:      
 
Domain Number - Region: 324-406
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0549
Family Myosin rod fragments 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G05130.1   Gene: BRADI2G05130   Transcript: BRADI2G05130.1
Sequence length 770
Comment pep:novel chromosome:Brachy1.0:2:3690901:3696030:-1 gene:BRADI2G05130 transcript:BRADI2G05130.1
Sequence
MGYVLLLPSPPLVAFRRHPSSAASGRHRARRGASIIASSSDGGPSPAQAPGYVLARRAVL
LGVSALPLLRDTAAKAAAPSNGGLLTETKEVSKVDEPQPGGTQAETPLLEAPQSESPTPV
VVQEQPQGNPLAGLLNAIAVVASGVLAALYGTSRQEKKALQSVVSSMETKLAENEAAISL
MRENYEKRLVEQQAARKKQSVKFQEQEASLLDQLASSKKTVTSLSEEFRREKTRAEELKN
EIQRLESSIAQAGDNNDVLEAKLTEKLNEIDVLQEKLSLLNQQADNKEKRIKELSSSLSS
KEVDYQNLCSFSDQTKESLELANVKIQQLEDEIHTTKNDLASKASLIDSLNEKLEILNSA
KNEAEERINELIKEYADLKASSETRASHDSELLSEKEDLLKHLEEKLSVALSDSSKDHEI
IVGLNKELAATKAMLEGEVVTVNSLRDSLQSTEETLRDSRTEVSKLSEELDEARRLNQDL
ELQISKLQEEFNEMQEGLTYKIGEVESVSRALSDELVSVKEMVQKGHEELEATSSQLASV
VEARDNLKKELLDVYKKFESTTQELVEERRTVTTLNRELEALAKQLQVDSQARRALEADL
DEATRSLDEMNTSALSLSKALESTHSKNSTLEAEKEVLSKALDEEKKKTIQAQENSDDAQ
NLISRLQTERESFEMRSRHLEEELALAKGEMLRLRRQISASRSQNTKILPRTSAATETSS
VPRTSAPTETSQVANEQPVNDRNQKTSEVASGAPYTVKRTTRRRKGGAST
Download sequence
Identical sequences I1HCP0
EG:BRADI2G05130.1 15368.BRADI2G05130.1 XP_003565429.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]