SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G05160.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G05160.1
Domain Number 1 Region: 934-1163
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.75e-45
Family ABC transporter ATPase domain-like 0.00000752
Further Details:      
 
Domain Number 2 Region: 695-916
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 3.92e-37
Family DNA repair protein MutS, domain III 0.0011
Further Details:      
 
Domain Number 3 Region: 397-518
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 2.22e-27
Family DNA repair protein MutS, domain I 0.00091
Further Details:      
 
Domain Number 4 Region: 544-591,625-707
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 0.00000235
Family DNA repair protein MutS, domain II 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G05160.1   Gene: BRADI2G05160   Transcript: BRADI2G05160.1
Sequence length 1229
Comment pep:novel chromosome:Brachy1.0:2:3714392:3723479:-1 gene:BRADI2G05160 transcript:BRADI2G05160.1
Sequence
MQPRRQQQSILSFLQPRRSPAGEDALGAGTDTGTPPERPPRPPAASVDGIMERLVRPPSQ
GRNKDVSQVKHVEISLPVKSQDPSHECPSALFSGPYKGKYSRETTLETTLFAEHGTNSIP
LQEPLKYSMRSSTDEFVRACTLFPEHGSDQTLQEYPKKFSSESPNNKYIQATSIFEEFDV
QTPSQNPLKRIFSGPSHGADTPLSEYGSDQTLLQHPSKKLPLVSSSGEYVRAATLFGLDS
NDTHTPKHAKKLFSRSSEPSYIKGTNLFAEFDSHGTPLQNHSKHSSVFMNGKHNGAPATL
FPELDSFSLKPEMPMTRAVTPRAKRVQQDQCVTTKNQHPPLWGSNKKVKSAHCSPAKKMV
HDEMAEIARSKFEWLNPLNIRDGNKRRPEDPLYDKRTLFIPPDALRKMSTSQKQYWTTKC
KYMDVVLFFKVGKFYELYEVDAEIGQKELDWKMTISGVGKCRQVGISESGIDDAVEKLLA
RGYKVGRIEQMESAVQAKARGPNSRIDRKLVNVSTPSTAADSNIGADAVHLLALKEVTLA
SNGSRVYGFAFLDYAALKIWVGSLHDDDSSAALGALLVQVSPREIIYESSGLSRESHKCM
TKYASAGSVKMQLTPLSRTDFSDSSQIRMSVHSKGYFKASTDSWLSALDYSMNQDAVICA
LGGLIGHLTRLMLDDALKNGEVLPYKVYQTCLRMDGQTLVNLEIFSNNFDGGSSGTLYKH
LNHCITASGKRLLRRWICHPLKDVDAINSRLDIVEGFIQNCGVGSITLEYLRKIPDLERL
LGRVRSTVGLTSDVMLPFVGERMLKRRIKTFGMLIKGLRVGIDLLSILQREDHGISALSK
SVDIPTLSSLGELIHQFEEAIDNDFPRYQDHDIKDDDANTLAILVELFVGKASEWSFVIN
AISNIDVLRSFGAMALSSFGTMCRPQILLKDKVPILRMKGLWHPYAFAESTTGLVPNDLS
LGQDLSGDNRFALLLTGPNMGGKSTIMRATCLAVVLAQLGCYVPCTSCELTLADSIFTRL
GAIDRIMSGESTFLVECTETASVLQNATEDSLVLLDELGRGTSTFDGYAIAYAVFRHLVE
RVRCRLLFATHYRPLTKEFASHPHVILQHMACMLRPKSGSNGDKEITFLYRLTAGASPES
YGLQVATMAGLPKSIVEKASVAGQMMKSKLTRNFKSSEGRAEFSTIHEEWLRTILAIGGV
KDAHLDEDTMDTMFCISHELKAHFRKGGR
Download sequence
Identical sequences I1HCP3
XP_010230542.1.954 15368.BRADI2G05160.1 EG:BRADI2G05160.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]