SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G06160.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G06160.1
Domain Number 1 Region: 462-626
Classification Level Classification E-value
Superfamily N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 2.62e-66
Family N5-CAIR mutase (phosphoribosylaminoimidazole carboxylase, PurE) 0.00000087
Further Details:      
 
Domain Number 2 Region: 174-374
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 5.13e-59
Family BC ATP-binding domain-like 0.00041
Further Details:      
 
Domain Number 3 Region: 76-169
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.18e-27
Family BC N-terminal domain-like 0.0023
Further Details:      
 
Domain Number 4 Region: 380-450
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 0.00000000000000314
Family BC C-terminal domain-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G06160.1   Gene: BRADI2G06160   Transcript: BRADI2G06160.1
Sequence length 632
Comment pep:novel chromosome:Brachy1.0:2:4618233:4625346:1 gene:BRADI2G06160 transcript:BRADI2G06160.1
Sequence
MHARLLSAPSRASAAATSSSSLPSAGDHPCRASWKPRPSRTSTSPPRPLSLRARASMEPA
PPEGQSDPPVHGVSNRVVGVLGGGQLGKMLCQAASQMGIKVAILDPLENCPASSVCHEHV
IGSFDDGDTVREFAKRCGVLTVEIEHVDAVTLEKLEKQGVVCEPKASTIMIIQDKYRQKE
HFSKFGIPLPDFVQVDNLSSIEKAGEMFGYPLMVKSKRLAYDGRGNAVAHNKRELSSVVS
SLGGFEHGLYVERWTPFAKELSVIVARSRDGSTVCYPVVQTIHKDNICHVVEAPAEIPEK
MKTLATGVAEKAVKSLEGAGVFAVELFLTNDNQVLLNEVAPRPHNSGHQTIEACYTSQYE
QHLRAILGFPLGDPSMKAPAAVMYNILGEDEGESGFVLAHQMIGRALNIPGASVHWYAKP
EMRKQRKMGHITIVGPSMFSVKARLDKLLQRDNDGLTKVRPRAAIIMGSDSDLPVMKDAK
EVLEKFNIPFELTIVSAHRTPQRMYEYALSAKERGLEVIIAGAGGAAHLPGMVASLTTVP
VIGVPIWTKSLQGMDSLLSIVQMPKGIPVATVAIGNAENAGLLAVRMLASRDPDLSDRMN
KYQQNLEDSVLEKARLLEELGPDDYLKQYMKP
Download sequence
Identical sequences I1HD09
XP_010230585.1.954 EG:BRADI2G06160.1 15368.BRADI2G06160.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]