SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G08050.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G08050.1
Domain Number 1 Region: 19-204
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 2.35e-49
Family SOUL heme-binding protein 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G08050.1   Gene: BRADI2G08050   Transcript: BRADI2G08050.1
Sequence length 214
Comment pep:novel chromosome:Brachy1.0:2:6443836:6447165:1 gene:BRADI2G08050 transcript:BRADI2G08050.1
Sequence
MASQRPVMLLLLLFIPSLLSPAARAAETPQYSMVHKESDFEVRLYRDTVWMSAPSDEISF
HVATKLGFHRLFQYLMGANLNSSRIRMTNPILTSIVPGAGPLHSSAYFVRLYLPANFQAS
PPVPLPELNLRPDRWPSHCIAARSFPGYARDNNVVEEAKKLAMSLSRSPWANSTNYPSEN
AYSVAQYSSPFRIIGRVNEVWFDVDCKSAGVETY
Download sequence
Identical sequences I1HDN2
15368.BRADI2G08050.1 EG:BRADI2G08050.1 XP_003566128.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]