SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for EG:BRADI2G08260.1 from Brachypodium distachyon

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  EG:BRADI2G08260.1
Domain Number 1 Region: 13-142
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.1e-36
Family Single strand DNA-binding domain, SSB 0.00000464
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: EG:BRADI2G08260.1   Gene: BRADI2G08260   Transcript: BRADI2G08260.1
Sequence length 144
Comment pep:novel chromosome:Brachy1.0:2:6663500:6666152:1 gene:BRADI2G08260 transcript:BRADI2G08260.1
Sequence
MSTAAAQGGEKPALRKPVFVKVDQLKPGTNGHTLVVKVVSANPVPGRTRPGAPASSSRPP
RIAECLVGDETGTIIFTARNDQVDVLKPGATAILRNAKIDMFKCSMRLAVDKWGRVEAAE
PASFTVKEDNNLSQVEYELVNVAE
Download sequence
Identical sequences I1HDQ6
15368.BRADI2G08260.1 EG:BRADI2G08260.1 XP_003566207.1.954

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]